DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cngb3 and CG42260

Sequence 1:NP_038955.1 Gene:Cngb3 MGIID:1353562 Length:694 Species:Mus musculus
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:461 Identity:151/462 (33%)
Similarity:254/462 (55%) Gaps:17/462 (4%)


Mouse   176 HQDTFSFKPQRVPVKEHLRRMILPRSIDSYTD---RVYLLWLLLVTIAYNWNCWLLPVRLVFPCQ 237
            ||     ||:|. ..:.:|.....|.:....|   |:...|.::|::|:.:|.|::..|..|...
  Fly   549 HQ-----KPRRT-ASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEI 607

Mouse   238 TPDNKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLLPF 302
            .......|...|.:.|.:||.|| |...|..::..|.:..|:.:|:.:|.:||.|.:|...|||.
  Fly   608 NRRTIAIWFCLDYLSDFLYLIDI-LFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPL 671

Mouse   303 EVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINACVYYWAS 367
            :.||:..|.|.|.|:.|::|...|:.|....|...:...::|......|||.:.|.|.|:|:...
  Fly   672 DFLYLSIGFNSILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIH 736

Mouse   368 DYEGIGSTKWVYNGEGN-----KYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFFSGVFVFS 427
            ...|.||..|||:...:     :||:.:||....|.|||.||:|::..|.||..|....|:.:|:
  Fly   737 KNNGFGSRNWVYHDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFA 801

Mouse   428 SLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWNSQRILDESNLLE 492
            :::|.:.:::.:.:|.:..|||.:|.:..||....:|..:|.:|..|.:|.|.:|:..||...:.
  Fly   802 TVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVS 866

Mouse   493 NLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIK 557
            .||..::..||::::...:.:||:|:..:...:.:|:|||:..::.|||::|:|||:||||||:.
  Fly   867 CLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVN 931

Mouse   558 HGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKG-GGNRRTADVVAHGFANLLTLDKKTLQEILL 621
            .|.:||: ..:|..|:.:|||||.|||||:|..| .||||||.|.:.|:::|..|.||.:.::|.
  Fly   932 RGRLQVV-ADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLK 995

Mouse   622 HYPTSK 627
            .||.::
  Fly   996 EYPAAR 1001

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cngb3NP_038955.1 Ion_trans 228..445 CDD:278921 66/222 (30%)
Crp 510..>640 CDD:223736 52/120 (43%)
CAP_ED 516..624 CDD:237999 49/109 (45%)
CG42260NP_001356969.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.