DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zbtb18 and CG31365

Sequence 1:NP_001012330.1 Gene:Zbtb18 MGIID:1353609 Length:531 Species:Mus musculus
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:479 Identity:112/480 (23%)
Similarity:197/480 (41%) Gaps:98/480 (20%)


Mouse    93 EGKLQFKD----LPIEDVL--------------AAASYLHMYDIVKVCKKKLKEKATTEADSTKK 139
            |.:|:|:|    :.::|.:              ..|:.:|. .:|| .:.:|:.|.|||......
  Fly   109 EDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHK-RLVK-SRLELRAKLTTELRKELA 171

Mouse   140 EEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPSKRDLAAEPGNMWMRLPSDSAGIP 204
            ||..|..  :.|...:..|.:..||.:  :..||.:      |..||...|.:.:.|....||..
  Fly   172 EEVRSEV--RKELAEEVRSQVRDDLRN--EVSEDIR------KEQLAMLLGELEVYLTEKKAGRW 226

Mouse   205 QAGGEAEPHATAAGKTVASPC-SSTESLSQRSVTSV----------RDSADVDCVLDLSVKSSLS 258
            ::...:||......|..|||. |.|::|.:|..:.|          :|:.:.:.:|..:...:.:
  Fly   227 ESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANN 291

Mouse   259 GVENLNSSYF-------SSQDVLRSNLV----------QVKVEKEASC-DESDVGTNDYDMEHST 305
            ...|::....       |.:|....|:|          ::.:...||. |::...|.::|.::..
  Fly   292 SDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGI 356

Mouse   306 VKESVSTNNRVQY---EPAHLAPLREDSVL----RELDREDKA--------------SDDEMMTP 349
            ...::..:..:|:   :|..:    ||.|:    .|:.:|.:.              :|.:..||
  Fly   357 TSYNIKEDGEIQFSGEKPEEI----EDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTP 417

Mouse   350 -----ESERVQVEGGMENSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIR 409
                 .||.|..:   |:|.....:..::...:.|.|.||...||:..:|..|.:||.:   |::
  Fly   418 LKRKRSSELVFKQ---ESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIK---GLK 476

Mouse   410 SKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKP 474
            |.....:..|:|:|   ..||..:||||...|:|.||:.|::|..||.....|.||...||..|.
  Fly   477 SGKGGTLKCPSCAL---QLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKR 538

Mouse   475 HACKWCERRFTQSGDLYRHIRKFH 498
            |.|..|...|.|..:|.:||.:.|
  Fly   539 HQCPQCSSCFAQKSNLQQHIGRVH 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Zbtb18NP_001012330.1 BTB 23..119 CDD:306997 7/44 (16%)
COG5048 <303..>490 CDD:227381 55/213 (26%)
C2H2 Zn finger 381..401 CDD:275368 8/20 (40%)
C2H2 Zn finger 421..441 CDD:275368 8/20 (40%)
zf-H2C2_2 434..456 CDD:316026 11/22 (50%)
C2H2 Zn finger 449..469 CDD:275368 7/20 (35%)
C2H2 Zn finger 477..495 CDD:275368 7/18 (39%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 33/147 (22%)
RRF <161..222 CDD:294170 18/71 (25%)
zf-C2H2_8 454..530 CDD:292531 29/82 (35%)
C2H2 Zn finger 485..505 CDD:275368 9/23 (39%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.