DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSX1 and CG34367

DIOPT Version :10

Sequence 1:NP_055403.2 Gene:VSX1 / 30813 HGNCID:12723 Length:365 Species:Homo sapiens
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:133 Identity:52/133 - (39%)
Similarity:66/133 - (49%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    93 PAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASP 157
            |.|:...|...::.|.|.|  .:|..|.....|.|:..|: ..|.:.||                
  Fly   141 PTASITECTEDSNTPKLAP--DKPLLPEECVSPEPSRNRE-HCDPLDTS---------------- 186

Human   158 TLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKR 222
             |...|:||.||.||..||.|||:.|.|.||||.:.||.|:.:..|.|.|:||||||||||.||.
  Fly   187 -LVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKH 250

Human   223 EKR 225
            |.:
  Fly   251 ENQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSX1NP_055403.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Octapeptide motif 31..38
PRK14959 <47..>149 CDD:184923 14/55 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..167 11/53 (21%)
Nuclear localization signal. /evidence=ECO:0000255 161..166 1/4 (25%)
Homeodomain 165..221 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..365
CG34367NP_001097140.1 Homeodomain 193..249 CDD:459649 33/55 (60%)
OAR 392..410 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.