DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSX1 and eve

DIOPT Version :10

Sequence 1:NP_055403.2 Gene:VSX1 / 30813 HGNCID:12723 Length:365 Species:Homo sapiens
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:116 Identity:40/116 - (34%)
Similarity:61/116 - (52%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   122 PSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEA 186
            |..|||:     .::.:|:.|........:::.|.|::     ||:||.||..||..|||.|.:.
  Fly    38 PQTPPPS-----PNECLSSPDNSLNGSRGSEIPADPSV-----RRYRTAFTRDQLGRLEKEFYKE 92

Human   187 HYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREK---RWGGSSVMAE 234
            :|.....|..||.:..|||..|:|||||||.| .||::   .|..::|.::
  Fly    93 NYVSRPRRCELAAQLNLPESTIKVWFQNRRMK-DKRQRIAVAWPYAAVYSD 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSX1NP_055403.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Octapeptide motif 31..38
PRK14959 <47..>149 CDD:184923 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..167 9/44 (20%)
Nuclear localization signal. /evidence=ECO:0000255 161..166 0/4 (0%)
Homeodomain 165..221 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..365
eveNP_523670.2 Homeodomain 71..127 CDD:459649 28/56 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.