DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Slc22a4 and CG4630

Sequence 1:NP_062661.1 Gene:Slc22a4 MGIID:1353479 Length:553 Species:Mus musculus
Sequence 2:NP_001260948.1 Gene:CG4630 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:588 Identity:178/589 (30%)
Similarity:308/589 (52%) Gaps:92/589 (16%)


Mouse     3 DYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVPDTVNL-----SSSW 62
            |:|:::..:||:|.|||..:.|:...::....|.:|.||.||:|.:||.||:...|     .::|
  Fly    14 DFDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGANW 78

Mouse    63 RNHSIPLE-TKDGRQVPQSCRRYRLATIANFSAM--GLEPGQDVDLEQ-------LEQESCLDGW 117
            .:.::|.. :|.|...|.:|.|:    :||...:  ..:|.....|:|       .|.|.|    
  Fly    79 VSIAVPGSWSKRGHFTPSTCERF----VANGDHLESSSDPWSAWPLDQCFAENFTTETERC---- 135

Mouse   118 EYDKDIFLS---TIVTEWNLVC-EDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMA 178
              ::.::.|   |||.:|.|.| |:.||.....::.|.|::.|:.:||.|:||:|||.:      
  Fly   136 --NQFVYGSSERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHI------ 192

Mouse   179 VQTGFSFVQIF--------STNWEMFTVLF--AIVGMGQISNYVVAFILGTEILSKSVRIIFSTL 233
                |.|..:|        :.:|:..:.||  .:..:|....|.:|||:|.|::....|.: |::
  Fly   193 ----FLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREM-SSI 252

Mouse   234 GVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFAEAEQIIQ 298
            .:..|:|:|..:|.| :.|:.|||.|.|||::|.|.||..:|.:|||.|||:::.|..:|..||:
  Fly   253 VLNYFYAVGEALLGL-SVFLPDWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIR 316

Mouse   299 KAAKMNSIVAPAGIFDPLELQELNS--------------LKQQKV--IILDLFRTRNIATITVMA 347
            :|||:|.......:....:.|||::              .|..|:  .:.::.|:..:.....:.
  Fly   317 RAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAIL 381

Mouse   348 VMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFW--- 409
            :::|.:.::.|:.||||..:|.|:.|||..|..|:|:|.|..|||.||...||..::|.|..   
  Fly   382 LLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSI 446

Mouse   410 ---GGGVLLLIQVVPEDY----------------NFVSIGLVMLGKFGITSAFSMLYVFTAELYP 455
               ..|.:.|.|   .|:                |::.:.|.::||.||||:|:::|.||||:.|
  Fly   447 TCVASGFVTLAQ---GDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMP 508

Mouse   456 TLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGIITLFFPESFGVTLPEN 520
            |::|:..||:.|..:|.|:::||:...|.:|...||.:|.|:|:::.|:::|..||:|...||:.
  Fly   509 TVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDT 573

Mouse   521 LEQ 523
            :|:
  Fly   574 VEE 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slc22a4NP_062661.1 2A0119 12..519 CDD:273328 175/574 (30%)
MFS 123..510 CDD:119392 136/439 (31%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 175/575 (30%)
MFS 158..533 CDD:119392 119/390 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C103672199
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.890

Return to query results.
Submit another query.