DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hic1l and CG31365

Sequence 1:NP_571558.2 Gene:hic1l ZFINID:ZDB-GENE-030620-1 Length:454 Species:Danio rerio
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:387 Identity:79/388 (20%)
Similarity:129/388 (33%) Gaps:145/388 (37%)


Zfish    84 SDETFEVLNL--SSLLKTANYLQLNDLANLCSSKINQNGSVNSLYCFGTSSSVLLYEDHSSDTEA 146
            |.|.|..:|:  |.::.|.|                     ..:|...::||    ||.:.|:  
  Fly   309 SGEDFREINMVGSDVVHTDN---------------------GEIYIINSASS----EDQNQDS-- 346

Zfish   147 YTSITPPKKRQNAGRRYNSKNKLDLGLDLSKRKSNLEKTVTDELSLSKTISNHKQIGTKGVCFPK 211
                ||...:.|....||.|...::... .::...:|..|.                        
  Fly   347 ----TPEFDQDNGITSYNIKEDGEIQFS-GEKPEEIEDVVV------------------------ 382

Zfish   212 EEKLIKPLDGAQERKRERSQRKSNFNGCIPLCRVGSQLSQ-NQTFTFQ---MSVKKEEDIEGKTD 272
                                    ||       :|.::|| .|.|:|.   :.|:||:      :
  Fly   383 ------------------------FN-------LGEEISQEQQVFSFHENVIIVEKEQ------N 410

Zfish   273 ETDGQNPI---GCTNFVYQKETFV---KDAGIDN---RYVCIPCEKGFPSSESLKSHVESHFDDD 328
            :.|.|.|:   ..:..|:::|:..   |...|.:   .:.|..|...||:.:.|..|..:|.   
  Fly   411 DRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHI--- 472

Zfish   329 LDVRVEDEEEEESDGVTRISKEAPEHLEPSPNKSLKDVDLLRPFPCNICGKMFTQRGTMTRHMRS 393
                                    :.|:.....:||         |..|....:...::.|||..
  Fly   473 ------------------------KGLKSGKGGTLK---------CPSCALQLSCASSLKRHMII 504

Zfish   394 HLSLKPFACEECGMRFTRQYRLTEHMRVHSGEKPYACQVCGGKFTQQRNLISHM-RMHTSAS 454
            |..||||.|.||.:.|:::..|..||..|:|.|.:.|..|...|.|:.||..|: |:|...|
  Fly   505 HTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNS 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hic1lNP_571558.2 BTB 18..119 CDD:306997 7/37 (19%)
C2H2 Zn finger 304..324 CDD:275368 6/20 (30%)
zf-C2H2 372..394 CDD:306579 5/22 (23%)
C2H2 Zn finger 374..394 CDD:275368 5/20 (25%)
zf-H2C2_2 387..411 CDD:316026 12/24 (50%)
C2H2 Zn finger 402..422 CDD:275368 7/20 (35%)
zf-H2C2_2 414..439 CDD:316026 9/25 (36%)
C2H2 Zn finger 430..450 CDD:275368 8/21 (38%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/112 (22%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.