DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pdx1 and Antp

Sequence 1:NP_571518.2 Gene:pdx1 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:221 Identity:69/222 (31%)
Similarity:91/222 (41%) Gaps:75/222 (34%)


Zfish    33 PPCLYMRQAHSVYA------------SPLGAQD--QPNLTDI--TSYNMSSRDDLAG-------- 73
            ||.:.....|.:.|            :.||..|  .|::|::  ..:||......:|        
  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPP 244

Zfish    74 -----------------PHLHLPQTSQTSLQSLGGYGDSLDLCGDRNRYHLP---FPWMKSTKSH 118
                             |..|.|.:...:.||.|                :|   :|||:|    
  Fly   245 QGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSG----------------MPSPLYPWMRS---- 289

Zfish   119 THAWKGQWTGPYMVEAEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKI 183
                       ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.|||
  Fly   290 -----------QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343

Zfish   184 WFQNRRMKWKKEEDKRRARGVDPEQD 209
            ||||||||||||...:...|...|.|
  Fly   344 WFQNRRMKWKKENKTKGEPGSGGEGD 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 37/53 (70%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.