DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pdx1 and unpg

Sequence 1:NP_571518.2 Gene:pdx1 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:261 Identity:73/262 (28%)
Similarity:104/262 (40%) Gaps:77/262 (29%)


Zfish     3 REEHYYPPNHLYKDSCAFQRHPNEDYSQNPPPCLYMRQAHSVYA-----SPLGAQDQPNL----- 57
            |.:|......:::|    |.:|.....|.|.|    .||||..|     ||:    :|.|     
  Fly   194 RLQHMAAAGRMHED----QANPGMAQLQEPTP----PQAHSSPAKSGSHSPM----EPALDVGMD 246

Zfish    58 ----------TDITSYNMSSRDDLAGPHLHLPQTSQTSLQSLGGY--GDSLDLCGDRNRYHLPFP 110
                      :|| |..||.|:          ...:......|.|  .||.|...|..       
  Fly   247 EDFECSGDSCSDI-SLTMSPRN----------YNGEMDKSRNGAYTNSDSEDCSDDEG------- 293

Zfish   111 WMKSTKSHTHAWKG----QWTGPYMVEAEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA 171
               :...|.....|    |..|  .....:::|.|||:|..||||||:||...||:|...|.::|
  Fly   294 ---AQSRHEGGGMGGKDSQGNG--SSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIA 353

Zfish   172 LTLSLTERHIKIWFQNRRMKWKKEEDKRRARGVDPEQDSSITSGDL-KDESCVGTATLAGPPSPL 235
            .:|.|:|..:||||||||.|||:.:             :.:||..| ::.:..||..:.  |.|:
  Fly   354 TSLKLSEVQVKIWFQNRRAKWKRVK-------------AGLTSHGLGRNGTTSGTKIVV--PIPV 403

Zfish   236 H 236
            |
  Fly   404 H 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 30/53 (57%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.