DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTT and htt

DIOPT Version :8

Sequence 1:NP_002102.4 Gene:HTT / 3064 HGNCID:4851 Length:3144 Species:Homo sapiens
Sequence 2:XP_012811191.1 Gene:htt / 493287 XenbaseID:XB-GENE-1013462 Length:3110 Species:Xenopus tropicalis

Alignment Length:3172 Identity:2450/3173 (77%)
Similarity:2756/3173 (87%) Gaps:94/3173 (3%)


Human     1 MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLP 65
            |||:||||:||||||||||||.                                           
 Frog     1 MATMEKLMRAFESLKSFQQQQV------------------------------------------- 22

Human    66 QPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIA 130
                          |.|.|||..:.||:.|..|||||||||||||||||||:|||||||||||||
 Frog    23 --------------PVVPEEPAPKAKKDPSTNKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIA 73

Human   131 MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL 195
            ||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||
 Frog    74 MELFLLCSDDAESDVRMVADECLNKVVKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL 138

Human   196 AHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIAN 260
            ||||||||||||||||||||||.|||.|||||||||||:|||||:||||||||||||||||||||
 Frog   139 AHLVRPQKCRPYLVNLLPCLTRISKRHEESVQETLAAAIPKIMAAFGNFANDNEIKVLLKAFIAN 203

Human   261 LKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVP 325
            ||||||.|||||||||||||.|||||||||:||||||||||:||||||.||||||||||||||:|
 Frog   204 LKSSSPAIRRTAAGSAVSICLHSRRTQYFYTWLLNVLLGLLIPVEDEHPTLLILGVLLTLRYLMP 268

Human   326 LLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPP 390
            ||||||||||||||||||:||.::|||||||:|:||||||:|||:||||||||||||||:|||||
 Frog   269 LLQQQVKDTSLKGSFGVTQKEADISPSAEQLIQIYELTLHYTQHRDHNVVTGALELLQQIFRTPP 333

Human   391 PELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALED 455
            .:||..||..|.|.|::..::|...||||||||||||||.|:||||::||||||:.|||||.|:|
 Frog   334 LDLLHVLTTPGSIEQVSVCRDEPYSRSRSGSIVELIAGGSSTCSPVIARKQKGKIHLGEEEGLDD 398

Human   456 DSESRSDVSSSALTASVKDEISGELAASSGVSTPGS----AGHDIITEQPRSQHTLQADSVDLAS 516
            |.|.:||..::.. |:.|:|:..::...|. :.||:    |.|||||||||||||||:||||::|
 Frog   399 DLEGKSDAPATPF-AATKNEVPSDVTNLSS-TAPGANLEGASHDIITEQPRSQHTLQSDSVDISS 461

Human   517 CDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDG-TQASSPISDSSQTTTEGPDSAVTPSDS 580
            .||.|:.|:|||||||||||||:|.|.||..|:||:| ||||||:||||||||||||||||||||
 Frog   462 SDLASTVTEGDEEDILSHSSSQISTVQSDTNMELNEGTTQASSPVSDSSQTTTEGPDSAVTPSDS 526

Human   581 SEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSS 645
            ||||||..::||.|:||||.|||::|...:..:||.|.|.:||:.|.|.||||.|.|.||.||||
 Frog   527 SEIVLDAAESQYSGMQIGQLQDEEDEGAILHQEEAGEHFGSSSLGLNQTHLLKTMGHSRQSSDSS 591

Human   646 VDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVR 710
            |::||.::|..:|||.||||.|||||||...|.|:|||:||||||||||||||.|:|||||||||
 Frog   592 VERFVPKEEPVDPGDLENKPSRIKGDIGHYMDKDAAPLIHCVRLLSASFLLTGQKSVLVPDRDVR 656

Human   711 VSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCG 775
            |||||||:|||||||||.||||||||||:|.:|||..|.||||||||||:|||||||||||||.|
 Frog   657 VSVKALAVSCVGAAVALLPESFFSKLYKLPTETTESQEIQYVSDILNYINHGDPQVRGATAILSG 721

Human   776 TLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLC 840
            |::.|:||::.|....|:..::..||||||:.||||||:|:|||||||||||||.|||:|:|:||
 Frog   722 TIVFSVLSKAHFEAETWISKVKANTGNTFSVQDCIPLLQKSLKDESSVTCKLACMAVRHCIMTLC 786

Human   841 SSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKL 905
            .|:|||||||||||:|||:|||||||||||||||||||||||:|:||:.||||||.|:|||||.|
 Frog   787 CSTYSELGLQLIIDLLTLKNSSYWLVRTELLETLAEIDFRLVNFMEARTENLHRGLHYYTGLLHL 851

Human   906 QERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHE 970
            |:||||||:|.||||:|.||||||||||.||||||||.|||.|||||||.||||||:||||||||
 Frog   852 QDRVLNNVIISLLGDDDARVRHVAAASLARLVPKLFYNCDQVQADPVVAAARDQSSIYLKLLMHE 916

Human   971 TQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLS 1035
            |||||||:||||||||||||:..|.||::||||:|:||.||||.|.|||||||||||||||||||
 Frog   917 TQPPSHFAVSTITRIYRGYNIQQSPTDISMENNISKVITAVSHALTTSTTRALTFGCCEALCLLS 981

Human  1036 TAFPVCIWSLGWHCG-----------------------VPPLSASDESRKSCTVGMATMILTLLS 1077
            ..:|||.||:|||||                       :...|.|:|.|||||.||::|||:|||
 Frog   982 ITYPVCTWSIGWHCGYVTSTSAQTSRIQVYKNRGRSFSISQQSPSEEPRKSCTAGMSSMILSLLS 1046

Human  1078 SAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQ 1142
            |||||||||||||||:|.||||||:|||||::.|.||||.:..|.||||.||||||||:|.||:|
 Frog  1047 SAWFPLDLSAHQDALVLVGNLLAATAPKSLKNPWTSEEETSQGANKQEEPWPALGDRAVVGMVDQ 1111

Human  1143 LFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSE 1207
            ||.||||.|||||||:||:.|||.:||.|||||||||||||||||||::..|||:|||||||..|
 Frog  1112 LFIHLLKAINICAHVIDDITPGPVVKATLPSLTNPPSLSPIRRKGKERDTAEQAAVPLSPKKSGE 1176

Human  1208 ASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSA 1272
            |:.||||::.|||..|||  |:||||||||||||:||||||:|||||:|||||:.||||||||||
 Frog  1177 ATPASRQTEASGPAQTSK--SIGSFYHLPSYLKLYDVLKATYANYKVSLDLQNNNEKFGGFLRSA 1239

Human  1273 LDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNP 1337
            |||||||||||||.||.||||||||||||||||||:||||||||||||||||||||||:.:||||
 Frog  1240 LDVLSQILELATLTDIAKCVEEILGYLKSCFSREPVMATVCVQQLLKTLFGTNLASQFEAMSSNP 1304

Human  1338 SKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQ 1402
            ||.||:|||||||::|||||||||||||||||||||||||||||||:||.|||||||||||||:|
 Frog  1305 SKCQGKAQRLGSSNLRPGLYHYCFMAPYTHFTQALADASLRNMVQADQEQDTSGWFDVLQKVSSQ 1369

Human  1403 LKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLL 1467
            ||.::::|||:|.|||||||||||||||||||||||||||.||||:|||||||||||||||||||
 Frog  1370 LKNSISNVTKHRTDKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQRQVLDLLAQLVQLRVNYCLL 1434

Human  1468 DSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMAS 1532
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
 Frog  1435 DSDQVFIGFVLKQFEYIEVGQFRESEAIIPNVFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMAS 1499

Human  1533 GRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQC 1597
            ||||||||||||||||||||||||.||||||||||||||||||||||||||||||||||||||||
 Frog  1500 GRKAVTHAIPALQPIVHDLFVLRGANKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQC 1564

Human  1598 HKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTP 1662
            |||||||||||||||||:|||||:|||||||||:||||:|||||.||||:|||||||||||||.|
 Frog  1565 HKENEDKWKRLSRQIADVILPMLSKQQMHIDSHDALGVINTLFETLAPSALRPVDMLLRSMFVVP 1629

Human  1663 NTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEE 1727
            .|||||||||||||||||||||||||||||||||||||||.||.||.|..|..||:||:....|.
 Frog  1630 CTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSLSPKLICCQNIMNLREGDNPLPPEV 1694

Human  1728 HSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSG 1792
            :.|..:.|..|||||||||||||||||||||.|:|||::||||||||||:|||||||||||||||
 Frog  1695 YPEQSENKPAPEETFSRFLLQLVGILLEDIVYKELKVDLSEQQHTFYCQQLGTLLMCLIHIFKSG 1759

Human  1793 MFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQ 1857
            .|||||.||.|||:.||..||||||:|||....||..|||:|||||||.|||:|:|:|.||:||.
 Frog  1760 TFRRITNAAMRLFKGDGSNGSFYTLESLNGLVESMFPTHPSLVLLWCQFLLLINYTNYSWWSEVH 1824

Human  1858 QTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLI 1922
            |||||:||||||||||.||.|.:|.||.:|.|:||||||||||||||||||||||||||||||||
 Frog  1825 QTPKRNSLSSTKLLSPHMSTESDDPDLTSKPGICNREIVRRGALILFCDYVCQNLHDSEHLTWLI 1889

Human  1923 VNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQS 1987
            |||:||||:|||||||||||||:|||||||||||||||||||||:.||.||||||||||||||||
 Frog  1890 VNHVQDLINLSHEPPVQDFISAIHRNSAASGLFIQAIQSRCENLAAPTSLKKTLQCLEGIHLSQS 1954

Human  1988 GAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQ 2052
            ||||.||:|:||||||||||||||.||||||||||||..|:|::|||||||:|:|||||||||||
 Frog  1955 GAVLLLYIDKLLCTPFRVLARMVDTLACRRVEMLLAATPQNSISQLPMEELDRMQEYLQSSGLAQ 2019

Human  2053 RHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSA 2117
            |||||||||||||::...|::||.|.|:||||||:...:|||:.|||:|||.||:|||:|.||||
 Frog  2020 RHQRLYSLLDRFRMTVAPDTVSPLPSVTSHPLDGENQATLETLDPDKEWYVSLVRSQCFTHSDSA 2084

Human  2118 LLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTV 2182
            |||||||||:|||.:.::||.:..||:|||||||:||:.:|||.|.|:.|:....|.:..:||:|
 Frog  2085 LLEGAELVNKIPAAERHSFMTSKNFNVSLLAPCLALGVHQISGEQDSSFFKTTLTVIVDLLSGSV 2149

Human  2183 QQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEK 2247
            :||||.|.|.||....|..|||.||:.||||:::|.||..|.||||||||.:.|||:..|:..||
 Frog  2150 EQLPAGHQVLQPLQQVESTAYWEKLSLLFGDSSVYCSLVALCRALAQYLVSLPKLPAEFHIQQEK 2214

Human  2248 EKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYC 2312
            |.|.|||:|..:||:||||:|||:|||:||||.:|.|||.||.|.||::::|:|:||||||||.|
 Frog  2215 EVDFVKFMVLCVEAISWHLVHEQVPLSMDLQAVIDYCCLTLQQPALWNLLASSEYVTHACSLIMC 2279

Human  2313 VHFILEAVAVQPGEQLLSPERRTNTPKAISE--EEEEVDPNTQNPKYITAACEMVAEMVESLQSV 2375
            |.||||||||:||:||||||||.|   .:||  ||::||.:.|...:|..||||:||||||||::
 Frog  2280 VRFILEAVAVEPGDQLLSPERRKN---KMSEDSEEDQVDSSEQKHVFIKTACEMMAEMVESLQTI 2341

Human  2376 LALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVE 2440
            |..||::|....|||||:.||||||||||||||||||||||||||||:||.||:|||:.||||||
 Frog  2342 LVFGHQKNRNFSAFLTPVFRNIIISLARLPLVNSYTRVPPLVWKLGWAPKWGGEFGTSLPEIPVE 2406

Human  2441 FLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAV 2505
            ||||||||:||||.|||||||||||||||||||||||||||:||:|:|:..||||||||||||||
 Frog  2407 FLQEKEVFREFIYCINTLGWTSRTQFEETWATLLGVLVTQPMVMDQDENQQEEDTERTQINVLAV 2471

Human  2506 QAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENI 2570
            ||||||||||||:.||||||:|.||||||||.|||||||||||||::|||||:|||||||||:||
 Frog  2472 QAITSLVLSAMTITVAGNPAISFLEQQPRNKSLKALDTRFGRKLSVVRGIVEEEIQAMVSKRDNI 2536

Human  2571 ATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLRE 2635
            ||||..||||||||||..|||.||:.|:||||||.|||:|:|||||||||||||||||:|||||:
 Frog  2537 ATHHSCQAWDPVPSLSAPTTGTLINQERLLLQINTEREIGNMSYKLGQVSIHSVWLGNNITPLRQ 2601

Human  2636 EEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILIS 2700
            ||.||:||:|.:.|.|||||.||:|||||||||||||||||||||||:||||:::.::|||||||
 Frog  2602 EELDEDEEDENENPTPSSPPMSPINSRKHRAGVDIHSCSQFLLELYSQWILPTNTGKKTPAILIS 2666

Human  2701 EVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPV 2765
            |||||||.||||||||||||:||..||||::.||||||||.||||||.|||||||||||.:||||
 Frog  2667 EVVRSLLTVSDLFTERNQFEMMYTALTELQKQHPSEDEILNQYLVPAICKAAAVLGMDKVIAEPV 2731

Human  2766 SRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQH 2830
            ||::|:||||:|:|||:|||||:||:|||||||||||||||||||||||||:|||||||:|:|||
 Frog  2732 SRIIETTLRSTHMPSRIGALHGILYILECDLLDDTAKQLIPVISDYLLSNLRGIAHCVNLHNQQH 2796

Human  2831 VLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSR 2895
            |||||||||||||||||||||||::.||||||||:|||||||||::|||.:||||||||||||||
 Frog  2797 VLVMCATAFYLIENYPLDVGPEFTSGIIQMCGVMVSGSEESTPSMVYHCVMRGLERLLLSEQLSR 2861

Human  2896 LDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERV 2960
            ||.|:||||||||||:|||||||.|||||||||||||||:||||.::|:||||||||||||||||
 Frog  2862 LDGEALVKLSVDRVNMHSPHRAMTALGLMLTCMYTGKEKISPGRATEPSPAAPDSESVIVAMERV 2926

Human  2961 SVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTL 3025
            ||||||||||||.|||||||||||||||||||||:||||||||||||||||||||||||||||||
 Frog  2927 SVLFDRIRKGFPFEARVVARILPQFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQTL 2991

Human  3026 HSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDV 3090
            |:|||||||||||||||||||||.|||||.|||||||||||||.|::||||||||||||.|.|||
 Frog  2992 HATGQSSMVRDWVMLSLSNFTQRTPVAMAMWSLSCFFVSASTSKWISAILPHVISRMGKSEPVDV 3056

Human  3091 NLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVT 3142
            |||||||.|||:|||:||||||:||||.|:||:|||||:|||.||:||||:|
 Frog  3057 NLFCLVAIDFYKHQIDEELDRRSFQSVFELVASPGSPYYRLLLCLQNVHKIT 3108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HTTNP_002102.4 Sufficient for interaction with TPR. {ECO:0000269|PubMed:15654337} 3..13 8/10 (80%)
CAG repeat region 18..40 4/22 (18%)
HEAT repeat 94..119 CDD:293787 21/25 (84%)
HEAT repeat 133..155 CDD:293787 22/22 (100%)
HEAT repeat 169..197 CDD:293787 28/28 (100%)
HEAT 1 206..243 33/37 (89%)
HEAT repeat 210..240 CDD:293787 27/30 (90%)
HEAT 2 248..285 35/37 (95%)
HEAT repeat 249..278 CDD:293787 28/29 (97%)
HEAT 3 318..362 37/44 (84%)
Interaction with ZDHHC17. {ECO:0000269|PubMed:28757145} 493..504 10/11 (91%)
HEAT 4 804..841 29/37 (78%)
HEAT 5 904..942 31/38 (82%)
DUF3652 1527..1553 CDD:289166 26/26 (100%)
Nuclear export signal. {ECO:0000250} 2397..2406 9/9 (100%)
httXP_012811191.1 HEAT repeat 76..98 CDD:293787 22/22 (100%)
HEAT repeat 112..140 CDD:293787 28/28 (100%)
HEAT repeat 153..183 CDD:293787 27/30 (90%)
HEAT repeat 192..221 CDD:293787 28/29 (97%)
DUF3652 1494..1520 CDD:289166 26/26 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C353572515
eggNOG 1 0.900 E1_28IQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1593
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D3022at7742
OrthoFinder 1 1.000 FOG0005433
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.