DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTT and htt

DIOPT Version :8

Sequence 1:NP_002102.4 Gene:HTT / 3064 HGNCID:4851 Length:3144 Species:Homo sapiens
Sequence 2:XP_009291239.1 Gene:htt / 30214 ZFINID:ZDB-GENE-990415-131 Length:3184 Species:Danio rerio

Alignment Length:3258 Identity:2273/3258 - (69%)
Similarity:2653/3258 - (81%) Gaps:190/3258 - (5%)


Human     1 MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLP 65
            |||:|||||||||||||||||                                            
Zfish     1 MATMEKLMKAFESLKSFQQQQ-------------------------------------------- 21

Human    66 QPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIA 130
                         ||..|||.:.:.||:|:.||||||.|||||||||||||:|.|||||||||||
Zfish    22 -------------GPLSAEELVQKQKKDLATTKKDRVTHCLTICENIVAQSLRTSPEFQKLLGIA 73

Human   131 MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL 195
            ||:|||||||.||||||||||||||:|||||||||||||||||||||||.|.|||||||||||||
Zfish    74 MEMFLLCSDDKESDVRMVADECLNKIIKALMDSNLPRLQLELYKEIKKNAASRSLRAALWRFAEL 138

Human   196 AHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIAN 260
            ||||||||||||||||||||||.:||.||:|||||::::|||||:.|:||||.|||:|||||:||
Zfish   139 AHLVRPQKCRPYLVNLLPCLTRITKRQEETVQETLSSSIPKIMAALGHFANDGEIKMLLKAFVAN 203

Human   261 LKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVP 325
            |||||||||||||.||||:|||||||.|||:|||||||||:|||::|||:.||||||||||||:|
Zfish   204 LKSSSPTIRRTAASSAVSVCQHSRRTHYFYTWLLNVLLGLVVPVDEEHSSHLILGVLLTLRYLMP 268

Human   326 LLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPP 390
            |:|||...||||||||:.|||.:|:|:.|||:||||||||:|||.||||||.:||||||:|||||
Zfish   269 LIQQQTPSTSLKGSFGLVRKEADVTPAPEQLIQVYELTLHYTQHWDHNVVTASLELLQQMFRTPP 333

Human   391 PELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALED 455
            ||||..|...|.|...:..:||...|:|||||:|||| |||:|||:|.||||||:|.||||.|||
Zfish   334 PELLNVLITRGKITHTSVFREEVESRARSGSILELIA-GGSTCSPLLLRKQKGKLLSGEEEGLED 397

Human   456 DSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPR-SQHTLQ-ADSVDLASCD 518
            |.| |::|::.:.||||..:.|.|..:|||||:.|::  |||||||| |||.|| .|||||::.:
Zfish   398 DPE-RAEVTTGSFTASVGGDSSSEAPSSSGVSSLGTS--DIITEQPRSSQHALQPGDSVDLSASE 459

Human   519 L---TSSATDGDEEDILSHSSSQVSAVPS---DPAMDLND---GTQASSPISDSSQTTTEGPDSA 574
            .   ..:..:.||||:||.|||..:.:.|   |...|.|.   |..:|||.|:||||||||||||
Zfish   460 QGVGPDTPDEEDEEDMLSRSSSGGAGLVSTSGDLVTDANQMSAGAVSSSPPSESSQTTTEGPDSA 524

Human   575 VTPSD------------------------------------------------------------ 579
            |||||                                                            
Zfish   525 VTPSDCAELVSVTSTSRRYRKYSPPSPTLTEGPDTQSESGSSVYRPSSSSTSSTSSSSSTFSAIS 589

Human   580 ---SSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQP 641
               ||:.||||:::||.|:|||..|||:||.:...||:..|.|..|::||.:.|||:...|.||.
Zfish   590 SSSSSDQVLDGSESQYSGMQIGTLQDEEEEGSAPPPDKPPEPFSQSALALSKPHLLEGKGHNRQS 654

Human   642 SDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPD 706
            ||||||:|:.::|..||.:.:|||.|||||||..||....||:||||||:|||||||.:|.||||
Zfish   655 SDSSVDRFIPKEEVLEPAELDNKPSRIKGDIGHYTDPKEEPLMHCVRLLAASFLLTGQRNGLVPD 719

Human   707 RDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATA 771
            .:|||||||||:||||||.||.||:||:.||..|||..:..|:||:||||.||:|||.|:|||||
Zfish   720 NEVRVSVKALAVSCVGAAAALLPEAFFNLLYLQPLDGQQTEEQQYISDILQYIEHGDHQIRGATA 784

Human   772 ILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCV 836
            ||||.||.:|..::|::...|:..|:::||::.:|.:.:|||:::||||||||||:||.|||:|:
Zfish   785 ILCGALIQAIQLKTRYNTETWLSQIQSVTGSSVTLENFVPLLQRSLKDESSVTCKMACAAVRHCI 849

Human   837 MSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTG 901
            |:||:.|.|||||||:||:|||:|.||||||||||||||||||||:||||.|.|.||:|.|||||
Zfish   850 MALCNGSLSELGLQLLIDLLTLKNCSYWLVRTELLETLAEIDFRLISFLERKTEKLHKGEHHYTG 914

Human   902 LLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKL 966
            ||:||:||||:||::||||||||||||||.::.||||:||:.|||||.|||||:|||||||:|:|
Zfish   915 LLRLQDRVLNDVVLYLLGDEDPRVRHVAANTIGRLVPRLFFDCDQGQTDPVVAIARDQSSVHLQL 979

Human   967 LMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEAL 1031
            |||||||||.|:||||||.|||:||..|..|||:||||||||.|:||.|.:||:||:||||||||
Zfish   980 LMHETQPPSQFTVSTITRTYRGFNLCQSAPDVTVENNLSRVITAISHALTSSTSRAMTFGCCEAL 1044

Human  1032 CLLSTAFPVCIWSLGWHCGVPPLS-----------------------ASDESRKSCTVGMATMIL 1073
            ||||:.||||.||.|||||....|                       :::|.|:|.|||:|:|:|
Zfish  1045 CLLSSTFPVCNWSTGWHCGFVSSSVFHLNRSSQYRSRGRSFSLSQSGSNEEVRRSLTVGVASMVL 1109

Human  1074 TLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVP 1138
            :|:|||||||||||||.||:||||||||.|||.::|.||.|||::||::|.||.||||.||:||.
Zfish  1110 SLISSAWFPLDLSAHQAALLLAGNLLAAVAPKCMKSPWAGEEESSPASSKVEEPWPALNDRSLVV 1174

Human  1139 MVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPK 1203
            |||||||||||::|||||||||..||||:||:||||.|.|||||||||||||:..|..:.|:|||
Zfish  1175 MVEQLFSHLLKILNICAHVLDDTPPGPAVKASLPSLANTPSLSPIRRKGKEKDMMEAGTTPMSPK 1239

Human  1204 KGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGF 1268
            ||.| |...|.:|::.....:||::||||||||.||||:|.|:||||||||||||.|..||||||
Zfish  1240 KGGE-SNTGRAADSTATAAVNKSTTLGSFYHLPPYLKLYDALRATHANYKVTLDLHNPNEKFGGF 1303

Human  1269 LRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGL 1333
            ||||||||||:||||||.|||||||||||||||||||||.|||||||||||.|||||||||::|.
Zfish  1304 LRSALDVLSQLLELATLHDIGKCVEEILGYLKSCFSREPTMATVCVQQLLKALFGTNLASQYEGA 1368

Human  1334 SSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQK 1398
            ||||.:|||:|.|||||||||||||||||||||||||||||||||||||||||.|.||||||:||
Zfish  1369 SSNPCRSQGKALRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQEQDASGWFDVMQK 1433

Human  1399 VSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVN 1463
            ||.||::::|:||::|.|||||||||||||||||||||||||:|.|.||:|||||||||||||||
Zfish  1434 VSNQLRSSITNVTRHRGDKNAIHNHIRLFEPLVIKALKQYTTSTSVALQRQVLDLLAQLVQLRVN 1498

Human  1464 YCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDG 1528
            |||||||||||||||||||||||||||:||.|:|||||||||||||||||||||.||||||||||
Zfish  1499 YCLLDSDQVFIGFVLKQFEYIEVGQFRDSEEIVPNIFFFLVLLSYERYHSKQIISIPKIIQLCDG 1563

Human  1529 IMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILV 1593
            ||||||||||||||||||||||||||||:|||||||||||||||||||||||||:||||||||||
Zfish  1564 IMASGRKAVTHAIPALQPIVHDLFVLRGSNKADAGKELETQKEVVVSMLLRLIQHHQVLEMFILV 1628

Human  1594 LQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSM 1658
            ||||||||||||||||||:|||||||:||||||:||||||||||||||.:||||||||||||:||
Zfish  1629 LQQCHKENEDKWKRLSRQVADIILPMIAKQQMHLDSHEALGVLNTLFESVAPSSLRPVDMLLKSM 1693

Human  1659 FVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTS 1723
            |:||:|:|||.|||||:||||||||||||||||||:||||||||.||||:||..|.||.|.|..:
Zfish  1694 FITPSTLASVGTVQLWVSGILAILRVLISQSTEDIILSRIQELSLSPYLLSCPTIRRLCDDDVPA 1758

Human  1724 TLE------EHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLL 1782
            ..|      |.:.|:..:..|||||:||||||||:||:||..||:||:|||||||||||:|||||
Zfish  1759 PPETLPVAMEDANGETPRFPPEETFARFLLQLVGVLLDDIANKQVKVDMSEQQHTFYCQQLGTLL 1823

Human  1783 MCLIHIFKSGMFRRITAAATRLFRSDGC-GGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVN 1846
            ||||||||||||||||||.::|.:::|. ||.||||:.||.....:|||||:|||||||:||::|
Zfish  1824 MCLIHIFKSGMFRRITAAGSKLLKAEGGEGGDFYTLEGLNSLVLQLITTHPSLVLLWCQVLLIIN 1888

Human  1847 HTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQN 1911
            :|:|.||:||.|||:||||||||||||..|||||..:  .||.||||||||||||||||||||||
Zfish  1889 YTNYTWWSEVHQTPRRHSLSSTKLLSPHSSGEEERPE--GKLTMCNREIVRRGALILFCDYVCQN 1951

Human  1912 LHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTL 1976
            ||||||||||.|||:.|||||||||||||.||||||||||||||||||||||:||.||.||||||
Zfish  1952 LHDSEHLTWLTVNHVSDLISLSHEPPVQDLISAVHRNSAASGLFIQAIQSRCDNLCTPVMLKKTL 2016

Human  1977 QCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRI 2041
            |||||||||||||:|.||||:||.|||||||||||.|||||||||||..||:|:||||:|||:||
Zfish  2017 QCLEGIHLSQSGALLMLYVDKLLNTPFRVLARMVDTLACRRVEMLLAETLQNSIAQLPLEELDRI 2081

Human  2042 QEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLV 2106
            |:|||:|||||||||.:|||||||.:..:|:.||..|:::||||||.....|.|.|:|:|||.||
Zfish  2082 QQYLQTSGLAQRHQRFFSLLDRFRATVAEDTTSPVAPITTHPLDGDPPPPPENVEPNKEWYVTLV 2146

Human  2107 KSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAR 2171
            ||||..|.:.||.|..||:.::|..|:||.|...:|||.|||.|||:|:..:.....:.||:.|:
Zfish  2147 KSQCCLRGEGALYETTELLTKLPQSDLNAIMTCKDFNLCLLASCLSVGVQRVCKDHGAVLFDTAQ 2211

Human  2172 EVTLARVSGTVQQLPAVHHVFQPELPAEPAA--YWSKLNDLFGDAALYQSLPTLARALAQYLVVV 2234
            :||..|::|.::.||:.|   ||.||:....  ||.|||.::|:...||::.:|...|:|||:.:
Zfish  2212 QVTFERLAGVIELLPSPH---QPLLPSSKVCPDYWQKLNQVYGEPGFYQTVLSLCGVLSQYLLSL 2273

Human  2235 SKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSS 2299
            |||||.:|:|.::|..|..|....:|.:.|.|:.:|:|.|:|:|..|.|.|||||.|.:|:..:|
Zfish  2274 SKLPSSMHIPKDRETLITTFSTLAIEVVVWRLLQDQLPQSVDMQMSLSCLCLALQQPAVWTHFTS 2338

Human  2300 TEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEE-EEEVDPNTQNPKYITAACE 2363
            ..::||.||:|:|:..::.||||.||:|.|.|||:      |||: |::||.:....::  ..||
Zfish  2339 HSYLTHTCSIIHCIQLLIHAVAVGPGDQFLRPERK------ISEQSEDQVDSSDNQREW--HCCE 2395

Human  2364 MVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGG 2428
            ::||:||.||:||.|||.:|..:||||||.|||:|||||||||||||||:||||||||||||..|
Zfish  2396 IMAELVEGLQTVLTLGHHKNKNIPAFLTPTLRNVIISLARLPLVNSYTRIPPLVWKLGWSPKLSG 2460

Human  2429 DFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQ-EESPPE 2492
            :||||.|||||||||||:||:||:||||||||:||||||||||||||||||||:.|:| ||:..|
Zfish  2461 EFGTALPEIPVEFLQEKDVFREFLYRINTLGWSSRTQFEETWATLLGVLVTQPITMDQEEETQQE 2525

Human  2493 EDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVE 2557
            ||.||||||||||||||||||||||:|.||||||||.|||||||.|||||||||||||:|||:||
Zfish  2526 EDLERTQINVLAVQAITSLVLSAMTLPTAGNPAVSCPEQQPRNKILKALDTRFGRKLSVIRGMVE 2590

Human  2558 QEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIH 2622
            :|||||||||:|||||..|||||||||||.:|.|.||||||||||||.|||:|:|.|||||||||
Zfish  2591 REIQAMVSKRDNIATHFPYQAWDPVPSLSSSTAGTLISHEKLLLQINTEREMGNMDYKLGQVSIH 2655

Human  2623 SVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILP 2687
            ||||||:|||||||||.|:||:|||||||:||..||:|||||||||||||||||||||||:||||
Zfish  2656 SVWLGNNITPLREEEWGEDEEDEADAPAPASPQLSPINSRKHRAGVDIHSCSQFLLELYSQWILP 2720

Human  2688 SS-SARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKA 2751
            .| |:|:||.:||||||||||.|||||||||||::|:.|||||::|||.|||||.||||||.|||
Zfish  2721 GSPSSRKTPVVLISEVVRSLLAVSDLFTERNQFDMMFSTLTELQKVHPPEDEILNQYLVPAICKA 2785

Human  2752 AAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNL 2816
            |||||||||:||||.|||||||||:|||||:|||||||||||||||||||:||||.:|:||||||
Zfish  2786 AAVLGMDKAIAEPVCRLLESTLRSTHLPSRIGALHGVLYVLECDLLDDTARQLIPTVSEYLLSNL 2850

Human  2817 KGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCAL 2881
            |.:|||||:|:|||||||||.|||::||||||||.||:|.|||:|.::||.|||:||||||||.|
Zfish  2851 KALAHCVNLHNQQHVLVMCAVAFYMMENYPLDVGSEFNAGIIQLCCMILSASEEATPSIIYHCVL 2915

Human  2882 RGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYT------GKEKVSPGRT 2940
            ||||||||||||||:|||:||||||||||:.||||||||||||||||||      ||||.||||.
Zfish  2916 RGLERLLLSEQLSRMDAETLVKLSVDRVNMPSPHRAMAALGLMLTCMYTGVAGEEGKEKGSPGRP 2980

Human  2941 SDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLS 3005
            :|.:|.||||||||||||||||||||||||||.||||||||||||||||||.||:||||||||||
Zfish  2981 ADADPTAPDSESVIVAMERVSVLFDRIRKGFPSEARVVARILPQFLDDFFPLQDVMNKVIGEFLS 3045

Human  3006 NQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPW 3070
            |||||||||||||||||||||:|||||||||||:|||||||||.|||||.|||||||||||||.|
Zfish  3046 NQQPYPQFMATVVYKVFQTLHATGQSSMVRDWVLLSLSNFTQRTPVAMAMWSLSCFFVSASTSQW 3110

Human  3071 VAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCL 3135
            ::|:||||||||||.:.||::||||||.|||||||:|||||||||||.|:||:|||||::||.||
Zfish  3111 ISALLPHVISRMGKSDTVDISLFCLVAMDFYRHQIDEELDRRAFQSVFEMVASPGSPYYQLLCCL 3175

Human  3136 RNVHKVTT 3143
            :::|:.|:
Zfish  3176 QSIHQDTS 3183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HTTNP_002102.4 Sufficient for interaction with TPR. {ECO:0000269|PubMed:15654337} 3..13 8/9 (89%)
CAG repeat region 18..40 4/21 (19%)
HEAT repeat 94..119 CDD:293787 20/24 (83%)
HEAT repeat 133..155 CDD:293787 19/21 (90%)
HEAT repeat 169..197 CDD:293787 25/27 (93%)
HEAT 1 206..243 26/36 (72%)
HEAT repeat 210..240 CDD:293787 21/29 (72%)
HEAT 2 248..285 31/36 (86%)
HEAT repeat 249..278 CDD:293787 25/28 (89%)
HEAT 3 318..362 30/43 (70%)
Interaction with ZDHHC17. {ECO:0000269|PubMed:28757145} 493..504 8/11 (73%)
HEAT 4 804..841 22/36 (61%)
HEAT 5 904..942 27/37 (73%)
DUF3652 1527..1553 CDD:289166 25/25 (100%)
Nuclear export signal. {ECO:0000250} 2397..2406 7/8 (88%)
httXP_009291239.1 HEAT repeat 76..98 CDD:293787 19/21 (90%)
HEAT repeat 112..140 CDD:293787 25/27 (93%)
HEAT repeat 153..183 CDD:293787 21/29 (72%)
HEAT repeat 192..221 CDD:293787 25/28 (89%)
DUF3652 1562..1588 CDD:289166 25/25 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C353917310
eggNOG 1 0.900 E1_28IQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H1593
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D3022at7742
OrthoFinder 1 1.000 FOG0005433
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132837
Panther 1 1.100 LDO PTHR10170
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
1111.220

Return to query results.
Submit another query.