DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTT and F21G4.6

DIOPT Version :8

Sequence 1:NP_002102.4 Gene:HTT / 3064 HGNCID:4851 Length:3144 Species:Homo sapiens
Sequence 2:NP_509663.3 Gene:F21G4.6 / 181204 WormBaseID:WBGene00009027 Length:2022 Species:Caenorhabditis elegans

Alignment Length:2096 Identity:385/2096 - (18%)
Similarity:705/2096 - (33%) Gaps:568/2096 - (27%)


Human  1258 LQNSTEKFGGFLRSALD------VLSQILELATLQDIGK----------------CVEEILGYLK 1300
            ::.|.|.|.....:.||      |.:|::.:.|:..|.|                .:|.:|..::
 Worm   211 IEESKEMFRVMFNTHLDKVIETFVSNQVVPVGTISMIRKSIHIYISGISVDSLKGLIEMLLLMIR 275

Human  1301 SCFSREPMMATVCVQQLLKTLFGTNLASQFDG-LSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAP 1364
            ...:.....|...:::|:|...     .|.|| :..|..|     .:.|.|..:|..:     ..
 Worm   276 DSSNEVAYDAFATLEELMKVEI-----PQMDGFVPGNFLK-----LKYGESISKPEEH-----VE 325

Human  1365 YTHFTQALADASLRNMVQAEQENDTSGWFDVL----QKVSTQLKTNLTS---------------- 1409
            ...|...|.:|.|...:   ||.......|:|    :|:|.....::|:                
 Worm   326 DVEFVDPLVNADLYEQL---QETKPPPKIDLLLEDFEKMSLNANRSVTNYVVAFLGKTFLLTGSE 387

Human  1410 --VTKNRADKN-----------------AIHNHIRLF---EPLVIKALKQYTTTTCVQLQKQV-- 1450
              :..:|..|:                 :|.|:...|   ..|:|..: .|:|:|..||.:|.  
 Worm   388 KLLKTDRQSKDSMKILALRVLNVICARTSIENYEVRFGDKNQLMIDVI-CYSTSTDDQLSQQAIK 451

Human  1451 ---------------LDLLAQLVQLRVNYCLLDSDQVFIGFVLKQ---FEYIEVGQFRESEAIIP 1497
                           |||...:.:.|.   ||||..|.....||.   .||:|:..||       
 Worm   452 FMFLVLQRGTEIYNGLDLFKSVKKFRY---LLDSVSVEHVLHLKNQQLLEYLEIMAFR------- 506

Human  1498 NIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADA 1562
                       ..|.:.....:.:|...|                |...::.|...:   |....
 Worm   507 -----------SLYSTHYDFSLAEITSAC----------------AFMSVMRDWIQV---NNIKE 541

Human  1563 GKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKW--KRLSRQIADII--------- 1616
            .|.||                  |:|.|...|:.|   ..|.|  .|....|:.::         
 Worm   542 NKHLE------------------VMERFQNCLKNC---VIDCWDSPRFINTISTMLNYHSSETAC 585

Human  1617 -------LPMLA---------------KQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMF 1659
                   ||:..               ||.::.|....|     |.|...|:.:: :..:||...
 Worm   586 EDQYPPSLPLRVDFPHVHRTSSKANRFKQIVYDDWRTTL-----LCEARMPTYVK-MTAILRESV 644

Human  1660 VTP----NTMASVSTVQLWISGIL-AILRVLISQSTEDIVLSRIQELSFSPYLISCTVIN----- 1714
            .:|    ..:..:|.:. |.|..| |:|:|:    |..:..|..:|..:..:.:..:|:|     
 Worm   645 NSPEFSHEKVPKLSRMH-WNSDTLPAVLQVM----TVSLSDSHSKEDCYHGFHVGMSVLNWVYRN 704

Human  1715 --RLRDGDSTSTLE--EHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYC 1775
              .:|....|....  :||..:....|...|..|..|        |...|.::....|:......
 Worm   705 VFIVRGAAETKEFPFLQHSRTEMDDTLGNRTEFRATL--------DAYYKTVQSSADEKLEQLLT 761

Human  1776 QELGTLLMCLIHIFKSGM--FRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLW 1838
            ..:..:|..:.|.||:..  ...|....|.||          ||..::  |..::.     |||.
 Worm   762 PTINLMLAAMAHDFKTSTENILEIIVYITVLF----------TLSPIS--ALKLLN-----VLLR 809

Human  1839 CQI--LLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSP-QMSGEE------EDSDL-AAKLGMCNR 1893
            |.:  .|:.:.|..|.:............:...|:.. :..|::      :|.:: ..|:|....
 Worm   810 CLLDPKLIESLTSGRVFYFASSNTNNFETNDEFLIEALKCDGDKYFNRWGDDMEVEKIKMGAMKE 874

Human  1894 EIVRRGALILFCDYVC---QNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFIS------AVHRNS 1949
            ||:.:...::.....|   :..::.:.:..:::..:...:.||...|.:..:.      |.....
 Worm   875 EILEQLEPLITQSLKCFRYRGKNEKKQVLQIMICLMNHKLKLSDADPTECLMKFAVSTFARPEEC 939

Human  1950 AASGLF------------IQAIQSRCENLSTPTMLKKTLQCLE--GIHLSQSGAVLTLYVDRLLC 2000
            |.|.||            .|..:|..:.:...|||.|:::.|.  ||..:.......|:..|...
 Worm   940 AHSELFDTLMHFLATATRFQKDESYQKPMIAATMLMKSIEKLSNPGIVNAMKAVSFALFNGRYEF 1004

Human  2001 TPFRVLARMVDILACRRVEMLLAANLQS---SMAQLPMEELNRIQEYLQSSGLAQRHQRLY-SLL 2061
            |.               :|..|..:..:   .|...|.|.|..:...|:.:....::|:|: |:|
 Worm  1005 TD---------------IEEFLHTSHSTWKLCMQVAPTETLYTLSLLLEKNEFGMKNQKLFWSVL 1054

Human  2062 DRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLET--VSPDK------------------------- 2099
               |..|..|||....|.|:..|.    |||.|  ::.||                         
 Worm  1055 ---REWTPHDSLKVEVPFSAIALP----VSLITNYLTSDKVNIFEIINQWLDDPVPENTLKECTI 1112

Human  2100 ---------------DWYVHLVKSQCWTR-------------SDSALLEGAELVNRIPAEDMNAF 2136
                           ||..:.  ..|:::             :||:||.     ||:...|::..
 Worm  1113 IVALYFTLNNGDRAIDWKRYF--EHCFSKFNNTKATHLLSKYADSSLLP-----NRVEESDLDEE 1170

Human  2137 MMNSEF----NLSLLAPCLS---LGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQP 2194
            :..::.    ||.....|.|   |..|.|..|:.|.|                    ...::.:.
 Worm  1171 LTGNDSVDIDNLLEKHHCGSIQDLCHSIICSGETSVL--------------------DFLNLIER 1215

Human  2195 ELPAEPAAYWSKL--------NDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDI 2251
            |.|.:. :.|..|        :||.....:...|..|..||::      :..|::.|.       
 Worm  1216 EYPNDD-SIWGFLLAEFRRLDDDLEHRLDITFRLQDLVDALSE------RFNSNMFLK------- 1266

Human  2252 VKFVVATLEALSWHLIHEQIP---LSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCV 2313
               ::........||.:..||   |..| |...|.......|.|:.:::.|...          :
 Worm  1267 ---LLGNTNLAGIHLNNLSIPKIKLMFD-QVSFDYTEDGYVLRGIRNLLVSPRM----------L 1317

Human  2314 HFILEAVAVQPGEQLLSPERRTNTPK---AISEEEEEVDPNTQNPKYITAACEM----VAEMVES 2371
            |||.|       ::|.:.:...|..:   .|...:..:...:|........|:|    |.|:.:.
 Worm  1318 HFISE-------DELETAQMFLNLAEKVAGIMTTDALIATYSQYRIDFQVKCDMDEAKVKEIKKF 1375

Human  2372 LQSVLAL---GHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWK-LGWSP------KP 2426
            ..|:.|.   .|.|:|       ......:.:..|.|::||...:|.:..| ..|.|      ||
 Worm  1376 ALSMFAFCQEAHLRHS-------KRFSKTLSACFRHPILNSMFNIPLVAMKCFNWVPVVEILRKP 1433

Human  2427 GGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPP 2491
               ..|..|  |...:.:..|.::...|::.:|..:..|||..:.|:..|:....:..|:.....
 Worm  1434 ---TITCLP--PTGHVCDVMVLEDMKRRLSKVGLVTNAQFEVLFTTMQAVIAHTVIGPEKMHHDE 1493

Human  2492 EEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIV 2556
            ::..||...:..|:|...:.:|:::..|..|:|:...:.:.|....|....|.|....       
 Worm  1494 KDVLEREARSCNALQLYIATILTSLKYPNGGDPSSGFVLKSPYISELFLQSTEFAHLC------- 1551

Human  2557 EQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISH-EKLLLQINPERELGSMSYKLGQVS 2620
                             :|...|...|  ..|.|..|..| :|.....:.:..|    |.:.|..
 Worm  1552 -----------------NLKSVWKCEP--RTAFTTPLERHDQKSWTHCDGKTNL----YGICQTP 1593

Human  2621 IHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWI 2685
            :.|:|....:.|:  |..........|..|.:...||..|       :|..|..:.|:.::..|.
 Worm  1594 LFSLWQLCGMMPI--EFRQHANYHRIDHSASNYFLTSATN-------IDTISNVKQLMNIFEYWY 1649

Human  2686 LPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCK 2750
              |.........|:..::.::|.:||.|.:.:..:.:..|.:.:.|....::.:|:.::.....|
 Worm  1650 --SQGIGELGDTLLHSILHTILYLSDFFDDPDLHKAVLRTTSIIYRHQYDQNSVLSSFVHAMFFK 1712

Human  2751 AAAVLGMDK-----AVAEPVS---RLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPV 2807
            :.||||.|.     ...||.|   :|:.|.|.:.....|:..|.||||:::.|..:..... |.:
 Worm  1713 SIAVLGADVHGTEFKPGEPESIALKLVSSGLSNDIKTVRIYTLAGVLYLVQSDSYESFISS-IDI 1776

Human  2808 ISDYLLSNLKGIAH-CVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEES 2871
            :|.||...||.:|: ...:.|.:....: |....|:|. |:.:..: ..:|:::   :|:.....
 Worm  1777 LSAYLEKYLKKLANGSGRVESDESQFAL-ALIIKLMET-PMRLKQD-KKTILKL---LLASMRVR 1835

Human  2872 TPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVN-----VHSPHRAMAALGLMLTCMYTG 2931
            ....|......|:|:||........:..:.|.:.||..:     ..:.:...|...:::..  ..
 Worm  1836 RERFIIELIAEGIEQLLCRSNEFNNEVINFVLVGVDSGDATPFPADNEYYCRAVYRILMVA--AT 1898

Human  2932 KEKVSPGRTSDPNPAAPDSESVIVAMERVSVL-FDRIRKGFPCEARVVARILPQFLDDFFPPQDI 2995
            :|||           |.|..|:......:.:: ||.:.:|....|  ::|.||.|.......:..
 Worm  1899 REKV-----------ANDEVSMTRIYNALQIIGFDMLSRGETAPA--ISRTLPFFSICVNGVETT 1950

Human  2996 MNKVIGEFLSN-QQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLS 3059
            ::|.|..|:.| .:...:|::|::.::.:|      ::..:.| .:.|..:.:|..        |
 Worm  1951 ISKYIERFVINGNKKDRRFVSTLINQIVET------AATSKKW-SVELKLYRERLK--------S 2000

Human  3060 CFFVSASTSPWVAAIL 3075
            ....:|..:.|:..||
 Worm  2001 KSVANADDNQWLLNIL 2016

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HTTNP_002102.4 Sufficient for interaction with TPR. {ECO:0000269|PubMed:15654337} 3..13
CAG repeat region 18..40
HEAT repeat 94..119 CDD:293787
HEAT repeat 133..155 CDD:293787
HEAT repeat 169..197 CDD:293787
HEAT 1 206..243
HEAT repeat 210..240 CDD:293787
HEAT 2 248..285
HEAT repeat 249..278 CDD:293787
HEAT 3 318..362
Interaction with ZDHHC17. {ECO:0000269|PubMed:28757145} 493..504
HEAT 4 804..841
HEAT 5 904..942
DUF3652 1527..1553 CDD:289166 2/25 (8%)
Nuclear export signal. {ECO:0000250} 2397..2406 1/8 (13%)
F21G4.6NP_509663.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354016747
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10170
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.