DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTT and Htt

DIOPT Version :8

Sequence 1:NP_002102.4 Gene:HTT / 3064 HGNCID:4851 Length:3144 Species:Homo sapiens
Sequence 2:NP_034544.1 Gene:Htt / 15194 MGIID:96067 Length:3120 Species:Mus musculus

Alignment Length:3145 Identity:2846/3146 (90%)
Similarity:2965/3146 (94%) Gaps:26/3146 (1%)


Human     1 MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLP 65
            |||||||||||||||||            |||||||...|.|||||||||||.||||||.|    
Mouse     1 MATLEKLMKAFESLKSF------------QQQQQQQPPPQAPPPPPPPPPPQPPQPPPQGQ---- 49

Human    66 QPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIA 130
                |||||||.|||  ||||||||||||||||||||||||||||||||||:|||||||||||||
Mouse    50 ----PPPPPPPLPGP--AEEPLHRPKKELSATKKDRVNHCLTICENIVAQSLRNSPEFQKLLGIA 108

Human   131 MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   109 MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL 173

Human   196 AHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIAN 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   174 AHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIAN 238

Human   261 LKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVP 325
            |||||||:||||||||||||||||||||||:||||||||||||:|:|||||||||||||||.|||
Mouse   239 LKSSSPTVRRTAAGSAVSICQHSRRTQYFYNWLLNVLLGLLVPMEEEHSTLLILGVLLTLRCLVP 303

Human   326 LLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPP 390
            |||||||||||||||||||||||||||.|||||||||||||||||||||||||||||||||||||
Mouse   304 LLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPP 368

Human   391 PELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALED 455
            |||||.||..||:||||..:||:.||.||||||||:|||||||||||||||||||||||||||||
Mouse   369 PELLQALTTPGGLGQLTLVQEEARGRGRSGSIVELLAGGGSSCSPVLSRKQKGKVLLGEEEALED 433

Human   456 DSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLT 520
            ||||||||||||..||||.||.||||||||||||||.||||||||||||||||||||||:.||||
Mouse   434 DSESRSDVSSSAFAASVKSEIGGELAASSGVSTPGSVGHDIITEQPRSQHTLQADSVDLSGCDLT 498

Human   521 SSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVL 585
            |:||||||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||
Mouse   499 SAATDGDEEDILSHSSSQFSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVL 563

Human   586 DGTDNQYLGLQIGQPQDEDEE-ATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKF 649
            ||.|:||||:||||||::||| |.|:|..|.|:.|||||:||||||||:.|.|.|||||||:||:
Mouse   564 DGADSQYLGMQIGQPQEDDEEGAAGVLSGEVSDVFRNSSLALQQAHLLERMGHSRQPSDSSIDKY 628

Human   650 VLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVK 714
            |.|||..|..|.|:|||||||||||..||||||||||||||||||||||.|..||||||||||||
Mouse   629 VTRDEVAEASDPESKPCRIKGDIGQPNDDDSAPLVHCVRLLSASFLLTGEKKALVPDRDVRVSVK 693

Human   715 ALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLIC 779
            ||||||:|||||||||||||:||||||:|||..||||||||||||||||||||||||||||||:.
Mouse   694 ALALSCIGAAVALHPESFFSRLYKVPLNTTESTEEQYVSDILNYIDHGDPQVRGATAILCGTLVY 758

Human   780 SILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSY 844
            |||||||..||||:|.|||||||||||.||||||:|||||||||||||||||||:||:|||||||
Mouse   759 SILSRSRLRVGDWLGNIRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVLSLCSSSY 823

Human   845 SELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERV 909
            |:|||||:||:|.|:||||||||||||:||||||||||||||||||:||||||||||.|||||||
Mouse   824 SDLGLQLLIDMLPLKNSSYWLVRTELLDTLAEIDFRLVSFLEAKAESLHRGAHHYTGFLKLQERV 888

Human   910 LNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPP 974
            ||||||:||||||||||||||.||.||||||||||||||||||||||||||||||||||||||||
Mouse   889 LNNVVIYLLGDEDPRVRHVAATSLTRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPP 953

Human   975 SHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFP 1039
            |||||||||||||||:|||||||||||||||||:|||||||||||||||||||||||||||.|||
Mouse   954 SHFSVSTITRIYRGYSLLPSITDVTMENNLSRVVAAVSHELITSTTRALTFGCCEALCLLSAAFP 1018

Human  1040 VCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAP 1104
            ||.|||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||
Mouse  1019 VCTWSLGWHCGVPPLSASDESRKSCTVGMASMILTLLSSAWFPLDLSAHQDALILAGNLLAASAP 1083

Human  1105 KSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKA 1169
            |||||||.||||||.|||:|||:|||||||.|||:||||||||||||||||||||||.|||||||
Mouse  1084 KSLRSSWTSEEEANSAATRQEEIWPALGDRTLVPLVEQLFSHLLKVINICAHVLDDVTPGPAIKA 1148

Human  1170 ALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYH 1234
            ||||||||||||||||||||||||||||.|:||||..||||||||||||||||.|||||||||||
Mouse  1149 ALPSLTNPPSLSPIRRKGKEKEPGEQASTPMSPKKVGEASAASRQSDTSGPVTASKSSSLGSFYH 1213

Human  1235 LPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYL 1299
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
Mouse  1214 LPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEVLGYL 1278

Human  1300 KSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAP 1364
            ||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||||
Mouse  1279 KSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQCRAQRLGSSSVRPGLYHYCFMAP 1343

Human  1365 YTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEP 1429
            ||||||||||||||||||||||.|.|||||||||||.||||||||||||||||||||||||||||
Mouse  1344 YTHFTQALADASLRNMVQAEQERDASGWFDVLQKVSAQLKTNLTSVTKNRADKNAIHNHIRLFEP 1408

Human  1430 LVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEA 1494
            |||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1409 LVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEA 1473

Human  1495 IIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNK 1559
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1474 IIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNK 1538

Human  1560 ADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQ 1624
            ||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||
Mouse  1539 ADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQVADIILPMLAKQQ 1603

Human  1625 MHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQS 1689
            |||||||||||||||||||||||||||||||||||:||:||||||||||||||||||||||||||
Mouse  1604 MHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFITPSTMASVSTVQLWISGILAILRVLISQS 1668

Human  1690 TEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILL 1754
            ||||||.|||||||||:|:||.||||||.|....||.|.||||| |:|||:||||||||||||||
Mouse  1669 TEDIVLCRIQELSFSPHLLSCPVINRLRGGGGNVTLGECSEGKQ-KSLPEDTFSRFLLQLVGILL 1732

Human  1755 EDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDS 1819
            ||||||||||:||||||||||||||||||||||||||||||||||||||||.||||.||||||:|
Mouse  1733 EDIVTKQLKVDMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFTSDGCEGSFYTLES 1797

Human  1820 LNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDL 1884
            ||.|.|||:.|||||||||||||||:||||:||||||||||||||||.||.|:||.|||||||..
Mouse  1798 LNARVRSMVPTHPALVLLWCQILLLINHTDHRWWAEVQQTPKRHSLSCTKSLNPQKSGEEEDSGS 1862

Human  1885 AAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNS 1949
            ||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||
Mouse  1863 AAQLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAIHRNS 1927

Human  1950 AASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILA 2014
            |||||||||||||||||||||.||||||||||||||||||||||||||||.||||.||||||.||
Mouse  1928 AASGLFIQAIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLGTPFRALARMVDTLA 1992

Human  2015 CRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPV 2079
            ||||||||||||||||||||.||||||||:||:|||||||||||||||||||||:||||||.|||
Mouse  1993 CRRVEMLLAANLQSSMAQLPEEELNRIQEHLQNSGLAQRHQRLYSLLDRFRLSTVQDSLSPLPPV 2057

Human  2080 SSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNL 2144
            :|||||||||.||||||||||||:.||:|||||||||||||||||||||||||||.|||:|||||
Mouse  2058 TSHPLDGDGHTSLETVSPDKDWYLQLVRSQCWTRSDSALLEGAELVNRIPAEDMNDFMMSSEFNL 2122

Human  2145 SLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLND 2209
            ||||||||||||||:.||||.||||||.|.|.||:..||||||||.||||.||.||.|||:||||
Mouse  2123 SLLAPCLSLGMSEIANGQKSPLFEAARGVILNRVTSVVQQLPAVHQVFQPFLPIEPTAYWNKLND 2187

Human  2210 LFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLS 2274
            |.||...||||..|||||||||||:||:|:|||||||||.|.|||||.|:|||||||||||||||
Mouse  2188 LLGDTTSYQSLTILARALAQYLVVLSKVPAHLHLPPEKEGDTVKFVVMTVEALSWHLIHEQIPLS 2252

Human  2275 LDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPK 2339
            |||||||||||||||:||||.|:||.|:||||||||:||.|||||:|||||:|||.||.|::||:
Mouse  2253 LDLQAGLDCCCLALQVPGLWGVLSSPEYVTHACSLIHCVRFILEAIAVQPGDQLLGPESRSHTPR 2317

Human  2340 AISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARL 2404
            |:  .:||||.:.||..::|:||||||:|||||||||||||||||.:|:|||.:|:||:||||||
Mouse  2318 AV--RKEEVDSDIQNLSHVTSACEMVADMVESLQSVLALGHKRNSTLPSFLTAVLKNIVISLARL 2380

Human  2405 PLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEET 2469
            ||||||||||||||||||||||||||||.|||||||||||||:.|||||||||||||:|||||||
Mouse  2381 PLVNSYTRVPPLVWKLGWSPKPGGDFGTVFPEIPVEFLQEKEILKEFIYRINTLGWTNRTQFEET 2445

Human  2470 WATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPR 2534
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
Mouse  2446 WATLLGVLVTQPLVMEQEESPPEEDTERTQIHVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPR 2510

Human  2535 NKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKL 2599
            ||||||||||||||||:||||||||||.|||:|||.||||.:|||||||||.||||||||||:||
Mouse  2511 NKPLKALDTRFGRKLSMIRGIVEQEIQEMVSQRENTATHHSHQAWDPVPSLLPATTGALISHDKL 2575

Human  2600 LLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKH 2664
            |||||||||.|:|||||||||||||||||:||||||||||||||||:|.|||:|||.||||||||
Mouse  2576 LLQINPEREPGNMSYKLGQVSIHSVWLGNNITPLREEEWDEEEEEESDVPAPTSPPVSPVNSRKH 2640

Human  2665 RAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTEL 2729
            |||||||||||||||||||||||||:|||||.||||||||||||||||||||.|||:||:|||||
Mouse  2641 RAGVDIHSCSQFLLELYSRWILPSSAARRTPVILISEVVRSLLVVSDLFTERTQFEMMYLTLTEL 2705

Human  2730 RRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLEC 2794
            |||||||||||.||||||||||||||||||.||||||||||||||||||||::|||||:||||||
Mouse  2706 RRVHPSEDEILIQYLVPATCKAAAVLGMDKTVAEPVSRLLESTLRSSHLPSQIGALHGILYVLEC 2770

Human  2795 DLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQ 2859
            |||||||||||||:|||||||||||||||||||||||||||||||||:||||||||||||||:||
Mouse  2771 DLLDDTAKQLIPVVSDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLMENYPLDVGPEFSASVIQ 2835

Human  2860 MCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLM 2924
            ||||||||||||||||||||||||||||||||||||||.|||||||||||||.||||||||||||
Mouse  2836 MCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDTESLVKLSVDRVNVQSPHRAMAALGLM 2900

Human  2925 LTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDF 2989
            ||||||||||.||||.|||:||.||||||||||||||||||||||||||||||||||||||||||
Mouse  2901 LTCMYTGKEKASPGRASDPSPATPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDF 2965

Human  2990 FPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMA 3054
            |||||:||||||||||||||||||||||||||||||||.||||||||||||||||||||.|||||
Mouse  2966 FPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSAGQSSMVRDWVMLSLSNFTQRTPVAMA 3030

Human  3055 TWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLE 3119
            .||||||.|||||||||:||||||||||||||||||||||||||||||||||||.||||||||.|
Mouse  3031 MWSLSCFLVSASTSPWVSAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEFDRRAFQSVFE 3095

Human  3120 VVAAPGSPYHRLLTCLRNVHKVTTC 3144
            |||||||||||||.||:||||||||
Mouse  3096 VVAAPGSPYHRLLACLQNVHKVTTC 3120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HTTNP_002102.4 Sufficient for interaction with TPR. {ECO:0000269|PubMed:15654337} 3..13 10/10 (100%)
CAG repeat region 18..40 7/22 (32%)
HEAT repeat 94..119 CDD:293787 24/25 (96%)
HEAT repeat 133..155 CDD:293787 22/22 (100%)
HEAT repeat 169..197 CDD:293787 28/28 (100%)
HEAT 1 206..243 37/37 (100%)
HEAT repeat 210..240 CDD:293787 30/30 (100%)
HEAT 2 248..285 36/37 (97%)
HEAT repeat 249..278 CDD:293787 28/29 (97%)
HEAT 3 318..362 42/44 (95%)
Interaction with ZDHHC17. {ECO:0000269|PubMed:28757145} 493..504 11/11 (100%)
HEAT 4 804..841 33/37 (89%)
HEAT 5 904..942 35/38 (92%)
DUF3652 1527..1553 CDD:289166 26/26 (100%)
Nuclear export signal. {ECO:0000250} 2397..2406 8/9 (89%)
HttNP_034544.1 HEAT repeat 72..97 CDD:293787 24/25 (96%)
HEAT repeat 111..133 CDD:293787 22/22 (100%)
HEAT repeat 147..175 CDD:293787 28/28 (100%)
HEAT 1 184..221 37/37 (100%)
HEAT repeat 188..218 CDD:293787 30/30 (100%)
HEAT 2 226..263 36/37 (97%)
HEAT repeat 227..256 CDD:293787 28/29 (97%)
Interaction with ZDHHC17. {ECO:0000250|UniProtKB:P42858} 471..482 11/11 (100%)
HEAT 3 783..820 33/37 (89%)
HEAT 4 883..921 35/38 (92%)
HEAT 5 1405..1442 36/37 (97%)
DUF3652 1506..1532 CDD:289166 26/26 (100%)
Nuclear export signal. {ECO:0000250} 2373..2382 8/9 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C353247173
eggNOG 1 0.900 E1_28IQ9
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H1593
Inparanoid 1 1.050 5617 1.000 Inparanoid score I104
Isobase 1 0.950 0 Normalized mean entropy S8379
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005433
OrthoInspector 1 1.000 T2454828
orthoMCL 1 0.900 OOG5_132837
Panther 1 1.100 LDO PTHR10170
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5295
TreeFam 1 0.960
1515.240

Return to query results.
Submit another query.