DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tcp1 and CCT1

Sequence 1:NP_571305.1 Gene:tcp1 ZFINID:ZDB-GENE-990714-24 Length:556 Species:Danio rerio
Sequence 2:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster

Alignment Length:553 Identity:410/554 (74%)
Similarity:477/554 (86%) Gaps:1/554 (0%)


Zfish     4 SPLSVLGQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEV 68
            ||||:.|.|.:|.|||:||||||.||:||||||||||||||||||||||||:||||||||:||||
  Fly     6 SPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEV 70

Zfish    69 EHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYI 133
            ||||||||.|||:|||:|||||||||||:||||||:|||||||||||||||||||:|||||.:||
  Fly    71 EHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYI 135

Zfish   134 NENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKGVARYPINSVNV 198
            :|:||...|:|||:.|:|.|||||||||||.|||||:.||||||.:||..|.:|.|.|.|.::||
  Fly   136 SEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAINV 200

Zfish   199 LKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQ 263
            |||||:|.:||.|:.|||||||:.||.|.|::.|||||||||||||||||:||||:||||:||:.
  Fly   201 LKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEA 265

Zfish   264 IRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATV 328
            ||.||.||||||:..||.:|.||||.:||:||:|:||||:.||||||||.|.|||.|||||||..
  Fly   266 IRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAF 330

Zfish   329 CSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSL 393
            .:||:|::|||:|:.||:|:|.||.|||:|||||||||.||||.:|||||||.|||.|||||||:
  Fly   331 ITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMERSV 395

Zfish   394 HDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAA 458
            ||||||||||||||.||.|||.|||||||||||:|||:.|||||||||||:|||||||||:||||
  Fly   396 HDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAA 460

Zfish   459 QDSTDLVAKLRAFHNEAQVNPDRKNLKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAI 523
            :|:||||||||::||.:|..|:|.:|||.||||:.|..||||:|||.||.|.|.|||||||||||
  Fly   461 KDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAI 525

Zfish   524 TILRIDDLIKLFPDQKEGGPSYQDAVQSGSLEG 556
            |||||||:|||.|:.| .|.||.||..:|.|:|
  Fly   526 TILRIDDMIKLNPEDK-SGKSYADACAAGELDG 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tcp1NP_571305.1 chap_CCT_alpha 6..541 CDD:274081 400/535 (75%)
TCP1_alpha 10..536 CDD:239451 396/526 (75%)
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 400/536 (75%)
TCP1_alpha 12..538 CDD:239451 396/526 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158989180
eggNOG 1 0.900 E1_COG0459
Hieranoid 1 1.000
Homologene 1 1.000 H5656
Inparanoid 1 1.050 809 1.000 Inparanoid score I458
OMA 1 1.010
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 1 1.000 T1051982
orthoMCL 1 0.900 OOG5_127998
Panther 1 1.100 LDO PTHR11353
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1484
TreeFam 1 0.960
ZFIN 1 1.500
1515.300

Return to query results.
Submit another query.