DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxc3a and Antp

Sequence 1:NP_001128157.2 Gene:hoxc3a ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:243 Identity:73/244 (30%)
Similarity:95/244 (39%) Gaps:85/244 (35%)


Zfish    19 TCSLQLKHRVRKAIGG-----------------GHHVTTLFTL---VGKQLKTRENSSTWKRHAE 63
            :|.||      .|:||                 |||:....||   :|              |.:
  Fly   161 SCKLQ------AAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMG--------------HPQ 205

Zfish    64 ESSSENDKG------------NVWNFQNLSNV----QHPYSFSDDGN-----HSLDPANALEREK 107
            ......|.|            |:..:|..|.|    ..|......|.     |...|.......:
  Fly   206 AQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ 270

Zfish   108 ACELSTSCLSTMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLE 172
            .....:|.:.:..|||||                  |::  |:...|    ||.|..:|..|.||
  Fly   271 NPNSQSSGMPSPLYPWMR------------------SQF--GKCQER----KRGRQTYTRYQTLE 311

Zfish   173 LEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEK 220
            |||||||:.||.|.||:|:|..|.||:|||||||||||||:||::|.|
  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 47/99 (47%)
Homeobox 162..214 CDD:306543 35/52 (67%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.