DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb8b and Antp

Sequence 1:NP_571256.1 Gene:hoxb8b ZFINID:ZDB-GENE-980526-291 Length:247 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:199 Identity:79/200 (40%)
Similarity:94/200 (47%) Gaps:61/200 (31%)


Zfish    24 YDCPSYTPDLGGRPSVLYGHNTGSAFQHAAQFPDFYHHGTSSFPHASYQQTPCAVAYPGDATGNI 88
            |...|..|.:|..|         ....|..|.|...|.|                 :||..|   
  Fly   231 YQQQSGVPPVGAPP---------QGMMHQGQGPPQMHQG-----------------HPGQHT--- 266

Zfish    89 LGQDGLQKQSFFGAPDSDFTQFGDCNLKVSGIRDDLESAEPCTAQLFPWMRPQ---ATGRRRGRQ 150
                          |.|.     :.|.:.||:          .:.|:||||.|   ...|:||||
  Fly   267 --------------PPSQ-----NPNSQSSGM----------PSPLYPWMRSQFGKCQERKRGRQ 302

Zfish   151 TYSRYQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEHNKDKFPSSKAE 215
            ||:|||||||||||.||.||||:||||::|||.|||||:||||||||||||||:.....|.|..|
  Fly   303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367

Zfish   216 QEEI 219
            .:||
  Fly   368 GDEI 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb8bNP_571256.1 Antp-type hexapeptide 134..139 4/5 (80%)
Homeobox 149..201 CDD:278475 44/52 (85%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.710 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.