DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pou3f2b and Antp

Sequence 1:NP_571235.1 Gene:pou3f2b ZFINID:ZDB-GENE-980526-370 Length:378 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:363 Identity:67/364 (18%)
Similarity:103/364 (28%) Gaps:172/364 (47%)


Zfish    74 PLGEQDIKPAVQSPRDEMHNSSNLQHQSRPPHLVHQ-THGNHHDSRAWRTTTAAHIPSMATSNGQ 137
            |...|..:.|.|:|:         |.|.:.|.:..| ||......                   |
  Fly   119 PSQNQQQQQAQQAPQ---------QLQQQLPQVTQQVTHPQQQQQ-------------------Q 155

Zfish   138 SLIYS----QPSFSVNGLIPGSG--------QGIH--------HH----------------SMRD 166
            .::|:    |.:....|::|..|        .|.|        ||                .:.:
  Fly   156 PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220

Zfish   167 AHEDHHSPHLSDH-------GHPPSQHQHQSH---QSHHDHSDEDTPTSDD-------------- 207
            .|::||:..:...       |.||....||..   |.|..|..:.||.|.:              
  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYP 285

Zfish   208 --LEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWL 270
              ..||.|..:::|                      .:.|..|::.|:                 
  Fly   286 WMRSQFGKCQERKR----------------------GRQTYTRYQTLE----------------- 311

Zfish   271 EEADSTSGSPTSLDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPAASEITSLADSLQLEKEV 335
                        |:|.....|...:|..||:                        |.:|.|.:..
  Fly   312 ------------LEKEFHFNRYLTRRRRIEI------------------------AHALCLTERQ 340

Zfish   336 VRVWFCNRRQK-EKRMTPPGGPLPGTEDVYGD--TPPH 370
            :::||.|||.| :|.....|.|..|.|   ||  |||:
  Fly   341 IKIWFQNRRMKWKKENKTKGEPGSGGE---GDEITPPN 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pou3f2bNP_571235.1 POU 200..274 CDD:197673 10/90 (11%)
Homeobox 295..348 CDD:278475 12/54 (22%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3844
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.