DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pou3f3a and pdm2

Sequence 1:NP_571225.2 Gene:pou3f3a ZFINID:ZDB-GENE-980526-220 Length:446 Species:Danio rerio
Sequence 2:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster

Alignment Length:294 Identity:127/295 (43%)
Similarity:160/295 (54%) Gaps:79/295 (27%)


Zfish   169 QSQQSLIYSQPGGFTVN--GMLNPPGSLVHPGLMRGESPEMDHHHHHHHHQQQHPHHHHHHQHHA 231
            :|||.   :.|...|.|  ||.:        .:|...:|.|         |||........:..:
  Fly   621 KSQQR---TPPNSMTANSLGMSS--------AVMTPNTPSM---------QQQPQLQQSTPKPTS 665

Zfish   232 GVNSHDS-----HSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRF 291
            |:....:     .|.|:|...::||||||.||||||||||||.|||||:|.||||.||||||.||
  Fly   666 GLTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF 730

Zfish   292 EALQLSFKNMCKLKPLLNKWLEEADST------------------TGSPTSIDKIAAQGRKRKKR 338
            |||.|||||||||||||.||||:||||                  :.:|.||     .||:||||
  Fly   731 EALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESI-----LGRRRKKR 790

Zfish   339 TSIEVSVKGALESHFLKCPKPSAQEITSLADNLQLEKEVVRVWFCNRRQKEKRM-------TPPG 396
            ||||.:|:..||..||...||:::||:.|::.|.::|||:|||||||||||||:       :|.|
  Fly   791 TSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLDLDSPTG 855

Zfish   397 VPQTPEDVYTHA-----------------GNGSF 413
            .|     :.:||                 |:|||
  Fly   856 TP-----LSSHAFGYPPQALNMSHMQMEGGSGSF 884

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pou3f3aNP_571225.2 POU 242..316 CDD:197673 59/74 (80%)
Homeobox 337..390 CDD:278475 31/53 (58%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 55/64 (86%)
Homeobox 789..842 CDD:278475 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11636
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.