DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxc5a and Antp

Sequence 1:NP_571219.2 Gene:hoxc5a ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:358 Identity:95/359 (26%)
Similarity:131/359 (36%) Gaps:131/359 (36%)


Zfish     1 MSSYVGKSF-----------SKQTQDASSCRMHTFDNYGAHSEFHESNYAY-------------- 40
            |:||...|:           .....|..:.:||   :|..::. |:.|..|              
  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMH---HYSQNAN-HQGNMPYPRFPPYDRMPYYNG 71

Zfish    41 EGLD-----------------LGGSF-----------------SSQIPTNSLRREAINTTDRARS 71
            :|:|                 :||..                 ..|.|:.:.:::......:...
  Fly    72 QGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQ 136

Zfish    72 SAAVQRTQ----------------SC---SALGSRSFVSTHGYNPLSHGLLSQKAEGNMEV---M 114
            ....|.||                ||   :|:|....|...|..||...:........|.:   |
  Fly   137 QQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHM 201

Zfish   115 EKPSGKSRTDDIKMETTSAIKQQTNS-------------------TQRQNQSQPQ---------- 150
            ..|..:....|:.:...:.:.|..::                   ...|.|..||          
  Fly   202 GHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHT 266

Zfish   151 ----------------IYPWMTKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEI 199
                            :|||| :.......:.||.|.:|||||||||||||||||||||||||||
  Fly   267 PPSQNPNSQSSGMPSPLYPWM-RSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEI 330

Zfish   200 ANNLCLNERQIKIWFQNRRMKWKKDSKLKVKGG 232
            |:.|||.|||||||||||||||||::|.|.:.|
  Fly   331 AHALCLTERQIKIWFQNRRMKWKKENKTKGEPG 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 47/53 (89%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.