| Sequence 1: | NP_571200.1 | Gene: | hoxd3a / 30349 | ZFINID: | ZDB-GENE-990415-120 | Length: | 396 | Species: | Danio rerio |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
| Alignment Length: | 249 | Identity: | 77/249 - (30%) |
|---|---|---|---|
| Similarity: | 102/249 - (40%) | Gaps: | 78/249 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Zfish 145 PAAGETCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 209
Zfish 210 QNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGSNHIGYSGQLPNVNSLSYDAPSPPSFAKPQQN 274
Zfish 275 IYGLAAY------TAPL----------GGCIPQQKRY----------------PGTEYDHHSMQG 307
Zfish 308 NGSFANANLQSSP-VYVGGNFVDSMPASGPMF-NLGHLPHPSSAS------VDY 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| hoxd3a | NP_571200.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 18..163 | 4/17 (24%) | |
| Abdominal-A | 116..237 | CDD:332641 | 45/91 (49%) | ||
| Antp-type hexapeptide | 126..131 | ||||
| Homeobox | 165..217 | CDD:306543 | 35/51 (69%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..246 | 2/26 (8%) | |||
| DUF4074 | 333..394 | CDD:315871 | 10/28 (36%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 364..396 | ||||
| zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 35/52 (67%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X14 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.770 | |||||