DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxd3a and zen2

Sequence 1:NP_571200.1 Gene:hoxd3a ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:249 Identity:77/250 (31%)
Similarity:102/250 (41%) Gaps:78/250 (31%)


Zfish   145 PAAGETCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWF 209
            |.|.....:|      |||.|||::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||
  Fly    33 PTATTRSSEK------SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWF 91

Zfish   210 QNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGSNHIGYSGQLPNVNSLSYDAPSPPSFAKPQQN 274
            ||||||.||....||.:                       |.|  ..|:...:.|.....|..|.
  Fly    92 QNRRMKLKKSTNRKGAI-----------------------GAL--TTSIPLSSQSSEDLQKDDQI 131

Zfish   275 IYGLAAY------TAPL----------GGCIPQQKRY----------------PGTEYDHHSMQG 307
            :..|..|      ||||          |...|..:.|                |..|:|      
  Fly   132 VERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFD------ 190

Zfish   308 NGSFANANLQSSP-VYVGGNFVDSMPASGPMF-NLGHLPHPSSAS------VDY 353
             .::|::.|...| :.:..|.::......||. |.....:.||||      |||
  Fly   191 -ANWASSWLGLEPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASSSDILDVDY 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxd3aNP_571200.1 Abdominal-A 116..237 CDD:332641 45/92 (49%)
Antp-type hexapeptide 126..131
Homeobox 165..217 CDD:306543 35/52 (67%)
DUF4074 333..394 CDD:315871 10/29 (34%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/53 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45664
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.