DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb8a and Antp

Sequence 1:XP_005171620.1 Gene:hoxb8a ZFINID:ZDB-GENE-990415-108 Length:246 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:102 Identity:64/103 (62%)
Similarity:77/103 (75%) Gaps:2/103 (2%)


Zfish   121 ETDNTEQSPSPTQLFPWMRPQV--AAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHAL 183
            :..|::.|..|:.|:||||.|.  ...|:||||||:|||||||||||.||.||||:||||::|||
  Fly   270 QNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 334

Zfish   184 GLTERQVKIWFQNRRMKWKKENNKDKFPSSKSEQEQI 220
            .|||||:|||||||||||||||.....|.|..|.::|
  Fly   335 CLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEI 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb8aXP_005171620.1 Homeobox 150..202 CDD:278475 44/52 (85%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.655 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.