DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb4a and unpg

Sequence 1:NP_571193.1 Gene:hoxb4a ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:276 Identity:78/277 (28%)
Similarity:105/277 (38%) Gaps:76/277 (27%)


Zfish    22 EYSQSDYLPSHSPDYYSAQRQDPSFQHESIYHQRSG------CADPPYSSCQGPGQPAAVISPR- 79
            |....||:.|.|             .|..:.|..:.      .|:|..:..|.|..|.|..||. 
  Fly   179 ELMNQDYVHSLS-------------VHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAK 230

Zfish    80 --GHVLPTTALSTPLPEPSHHCD-------SVTPSPPPACGQTPTSQNTSTVSSRKDPVVYPWMK 135
              .|.....||...:.| ...|.       |:|.||....|:...|:|.:..:|..:..      
  Fly   231 SGSHSPMEPALDVGMDE-DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDC------ 288

Zfish   136 KVHVNIVSPNYSGG---------------EPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIA 185
            .......|.:..||               :.:|.|||:|.:|:||||:|||..:||:...|.:||
  Fly   289 SDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIA 353

Zfish   186 HTLCLSERQIKIWFQNRRMKWKK------DHKL------PNTKI------RSNSASTNS--SGCP 230
            .:|.|||.|:||||||||.|||:      .|.|      ..|||      ..|..:..|  ....
  Fly   354 TSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLE 418

Zfish   231 TLCSNQSRASGPPPSL 246
            .:|     .|||.|.|
  Fly   419 KMC-----LSGPKPDL 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb4aNP_571193.1 Antp-type hexapeptide 130..135 0/5 (0%)
Homeobox 154..207 CDD:278475 32/53 (60%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.