DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb3a and zen2

DIOPT Version :9

Sequence 1:NP_571192.2 Gene:hoxb3a / 30339 ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:110 Identity:53/110 - (48%)
Similarity:72/110 - (65%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


Zfish   156 SSPSASSANAESSGGEKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLS 220
            ::|:|::.::|.            |||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:
  Fly    31 AAPTATTRSSEK------------SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALT 83

Zfish   221 ERQIKIWFQNRRMKYKKDQKSKG-IGSSSGGPSPTGSPPLPMQSS 264
            |||:||||||||||.||....|| ||:.      |.|.||..|||
  Fly    84 ERQVKIWFQNRRMKLKKSTNRKGAIGAL------TTSIPLSSQSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb3aNP_571192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..135
Antp-type hexapeptide 140..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..184 6/27 (22%)
Homeobox 184..236 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..290 12/29 (41%)
DUF4074 353..415 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.