DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb3a and zen2

DIOPT Version :10

Sequence 1:NP_571192.2 Gene:hoxb3a / 30339 ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:110 Identity:53/110 - (48%)
Similarity:72/110 - (65%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


Zfish   156 SSPSASSANAESSGGEKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLS 220
            ::|:|::.::|.            |||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:
  Fly    31 AAPTATTRSSEK------------SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALT 83

Zfish   221 ERQIKIWFQNRRMKYKKDQKSKG-IGSSSGGPSPTGSPPLPMQSS 264
            |||:||||||||||.||....|| ||:.      |.|.||..|||
  Fly    84 ERQVKIWFQNRRMKLKKSTNRKGAIGAL------TTSIPLSSQSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb3aNP_571192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..135
Antp-type hexapeptide 140..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..184 6/27 (22%)
Homeodomain 181..237 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..290 12/29 (41%)
DUF4074 353..415 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.