DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb3a and zen2

Sequence 1:NP_571192.2 Gene:hoxb3a ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:110 Identity:53/111 (48%)
Similarity:72/111 (65%) Gaps:19/111 (17%)


Zfish   156 SSPSASSANAESSGGEKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLS 220
            ::|:|::.::|.            |||:|||::|.||:|||:|||.|:||.|.||:|::..|.|:
  Fly    31 AAPTATTRSSEK------------SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALT 83

Zfish   221 ERQIKIWFQNRRMKYKKDQKSKG-IGSSSGGPSPTGSPPLPMQSS 264
            |||:||||||||||.||....|| ||:.      |.|.||..|||
  Fly    84 ERQVKIWFQNRRMKLKKSTNRKGAIGAL------TTSIPLSSQSS 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb3aNP_571192.2 Antp-type hexapeptide 140..145
Homeobox 184..236 CDD:278475 34/52 (65%)
DUF4074 353..415 CDD:290032
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/53 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45664
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.