DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb1a and unpg

Sequence 1:NP_571190.2 Gene:hoxb1a ZFINID:ZDB-GENE-990415-101 Length:316 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:277 Identity:81/278 (29%)
Similarity:115/278 (41%) Gaps:66/278 (24%)


Zfish    29 HHLDQAFPGPFHTGHA----SD-SYNADGRLYVGGSNQPPTAAAQHQHQNGIYAHHQHQNQTGMG 88
            |.||..|. ||:...|    :| ||.....|    .||      .:.|...::|..||....|  
  Fly   151 HPLDTRFL-PFNPAAAGVAPTDLSYRRLAEL----MNQ------DYVHSLSVHARLQHMAAAG-- 202

Zfish    89 LTYGGTGTTSYGTQACANSDYAQHQYFINPEQDGMYYHSSGFSTSNASPHYGSM----------A 143
                    ..:..|  ||...||.|....|:.     |||...:.:.||...::          :
  Fly   203 --------RMHEDQ--ANPGMAQLQEPTPPQA-----HSSPAKSGSHSPMEPALDVGMDEDFECS 252

Zfish   144 GAYCGAQGAVPAAPYQHHGCEGQDHQRAYSQGTYADLSASQGTEKDTDQPPPGKTFDWMKVKRNP 208
            |..| :..::..:|..::|...:....||:.....|.|..:|.:...:....|            
  Fly   253 GDSC-SDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMG------------ 304

Zfish   209 PKTGKVAEYGLGPQNTI-----RTNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKI 268
               ||.:: |.|..:..     ||.||::||.|||:|||..|||:...|.:||.:|:|:|.||||
  Fly   305 ---GKDSQ-GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKI 365

Zfish   269 WFQNRRMKQKKREKEGL 285
            ||||||.|. ||.|.||
  Fly   366 WFQNRRAKW-KRVKAGL 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb1aNP_571190.2 Homeobox 226..278 CDD:278475 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.