DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pou6f1 and pdm2

Sequence 1:NP_571188.1 Gene:pou6f1 ZFINID:ZDB-GENE-980526-530 Length:610 Species:Danio rerio
Sequence 2:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster

Alignment Length:511 Identity:130/512 (25%)
Similarity:194/512 (38%) Gaps:141/512 (28%)


Zfish   187 LAAASPAGGLLKLPFAGLQAATVLNSVQTQLQAPAQAVLQPQMSALQAMQQTQTTAATTASIVQK 251
            |..|.|..|...||              |..|.|...||.|..::.             ::||..
  Fly   384 LHIAPPRAGPTPLP--------------THQQPPVGEVLPPNSTSF-------------STIVDP 421

Zfish   252 ASEPSV-----------------------------SVATLQTAGLSINPAIISAASLGAQPQFIS 287
            ..|||:                             .:.:|...|.|.....:........||.:|
  Fly   422 PKEPSIYEQPAPNGRHCRPANKVMRHMSNSPTPPSPLRSLSDCGKSFEEEELELGENCEMPQNLS 486

Zfish   288 SLTTTPIITSAMSN----VAGLTSQLITNAQGQVIGTLPLLVNPASLAGAAAASALPAQGLQVQ- 347
            |......:.|.:.|    :|....:|....:.:.:.:    |||..  ..|.|.....|.||:| 
  Fly   487 SKRQARELDSELENEVLDLAPPPKRLAEEQEEEKVAS----VNPPQ--PVAFAPEEMHQALQLQL 545

Zfish   348 ------------------TVAPQLLLNSQGQIIATIG-----------------NGPTAAIP--- 374
                              .:|.|.||.:..|.:|...                 :.|.|..|   
  Fly   546 HSYIEMVRQLAPEAFPNPNLATQFLLQNSLQALAQFQALQQMKQQQREDPLPSYSTPLAKSPLRS 610

Zfish   375 STASVLPK------ATVPLTLTKTTTQGPVGKVAPSKVIIAPQP----SVVKPVTSLTAAGVIAC 429
            .:.|.:|:      .|.|.::|..:.......:.|:...:..||    |..||.:.||.|..:| 
  Fly   611 PSLSPVPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTSGLTVASAMA- 674

Zfish   430 GEMPTVGQLVNKPSAVKDEEAINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAI 494
                   :|...|     ||..:|||:.:|||.||.||:.||.||..||.|:....|..:||:.|
  Fly   675 -------KLEQSP-----EETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTI 727

Zfish   495 CRFEKLDITPKSAQKLKPVLERWLAEAELWNQKGQ------QNLMEFVGGEP----SKKRKRRTS 549
            .|||.|:::.|:..||||:|::||.:|:....|..      ..:...:...|    .::||:|||
  Fly   728 SRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTS 792

Zfish   550 FTPQAIEVLNTYFEKNSLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKIN 605
            ........|...|..|..||.:||:::::.||.|:||:|||||||||..|   :||
  Fly   793 IETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEK---RIN 845

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pou6f1NP_571188.1 POU 448..522 CDD:197673 36/74 (49%)
Homeobox 546..599 CDD:278475 24/53 (45%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 31/64 (48%)
Homeobox 789..842 CDD:278475 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121597543
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.