DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxd4a and zen2

Sequence 1:NP_001119917.1 Gene:hoxd4a ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:114 Identity:51/115 (44%)
Similarity:70/115 (61%) Gaps:10/115 (9%)


Zfish   144 VVYPWMK-KVHVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSE 207
            ::||.:: .|.........:..:.||||||::..|::|||:|||.|:||.|.|||||:..|.|:|
  Fly    20 MMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTE 84

Zfish   208 RQIKIWFQNRRMKWKKDHKLPNTKG------RSASVGNQHAQHAQKDSQ 250
            ||:||||||||||.||.   .|.||      .|..:.:|.::..|||.|
  Fly    85 RQVKIWFQNRRMKLKKS---TNRKGAIGALTTSIPLSSQSSEDLQKDDQ 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 35/53 (66%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.