DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb5a and Antp

Sequence 1:NP_571176.2 Gene:hoxb5a ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster

Alignment Length:367 Identity:108/368 (29%)
Similarity:142/368 (39%) Gaps:123/368 (33%)


Zfish     1 MSSYFVNSF------SGRYPNGPDYQLLNYGTSSSAMNASYRDSGTMHSGSYG------------ 47
            |:|||.||:      .|.||.       |..|...|....:......|.|:..            
  Fly    11 MTSYFTNSYMGADMHHGHYPG-------NGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPY 68

Zfish    48 YNYNGMDLS-------------------VNRSTSTGHFGAVGDNSRVFQSPAPETRFRQPSSCSL 93
            ||..|||..                   :.::.:.|..|......:..|.|:...:.:|......
  Fly    69 YNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQ 133

Zfish    94 ASPEPLP---------------------CSNSESLG-----PKGSSPP-SDQSTTTAGNNLNSNT 131
            ...:.||                     |....::|     |:|.||| .||   .:|:::|:..
  Fly   134 QLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQ---MSGHHMNAQM 195

Zfish   132 -------H------FTEIDEASASSETEEASHRANNSAPRTQQK--------------------- 162
                   |      :|::    ...:..|.....:|.....||.                     
  Fly   196 TLPHHMGHPQAQLGYTDV----GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQ 256

Zfish   163 -------QETTATSTTSATSDGQAPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFH 220
                   |.|..:...::.|.|....::||||    |......:.||.|..||||||||||||||
  Fly   257 MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR----SQFGKCQERKRGRQTYTRYQTLELEKEFH 317

Zfish   221 FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 262
            |||||||||||||||||||:|||||||||||||||||:||.|
  Fly   318 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb5aNP_571176.2 Antp-type hexapeptide 182..187 3/5 (60%)
Homeobox 204..256 CDD:278475 49/52 (94%)
AntpNP_996167.1 Homeobox 301..353 CDD:278475 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45659
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.