DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: hoxb5a and unpg

Sequence 1:NP_571176.2 Gene:hoxb5a ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:264 Identity:74/265 (28%)
Similarity:108/265 (41%) Gaps:57/265 (22%)


Zfish    14 PNGPDYQLLNYGTSSSAM---NASYRDSGTMHSGSYGYNYNGMDLSVNRSTSTGHFGAVG----D 71
            |:..|.:.|.:..:::.:   :.|||....:.:..|.::     |||:....  |..|.|    |
  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHS-----LSVHARLQ--HMAAAGRMHED 207

Zfish    72 NSR----VFQSPAPETRFRQPSSCSLASP-EP-LPCSNSESLGPKGSSPPSDQSTTTAGNNLNS- 129
            .:.    ..|.|.|......|:.....|| || |.....|.....|.| .||.|.|.:..|.|. 
  Fly   208 QANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDS-CSDISLTMSPRNYNGE 271

Zfish   130 -----NTHFTEID-EASASSETEEASHRANNSAPRTQQKQETTATSTTSATSDGQAPQIFPWMRK 188
                 |..:|..| |..:..|..::.|.......:..|...:::.|.:                 
  Fly   272 MDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS----------------- 319

Zfish   189 LHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRM 253
                        :|.|||:|..|.||||:|||..:||:...|.:||.:|.|||.|:||||||||.
  Fly   320 ------------RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372

Zfish   254 KWKK 257
            |||:
  Fly   373 KWKR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hoxb5aNP_571176.2 Antp-type hexapeptide 182..187 0/5 (0%)
Homeobox 204..256 CDD:278475 32/52 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.