DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Thg1l and THG

Sequence 1:NP_001013988.1 Gene:Thg1l RGDID:1359513 Length:298 Species:Rattus norvegicus
Sequence 2:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster

Alignment Length:265 Identity:150/266 (56%)
Similarity:188/266 (71%) Gaps:19/266 (7%)


  Rat    30 MAKSKFEYVRDFEVDDTCLPHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALHLMTKCAQTVMQEL 94
            ||.|:||||:.||.||:.||:.|:|:|:||:.||:|::.|:|.||||..||::|...|..||||.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

  Rat    95 EDIVIAYGQSDEYSFVFRKRSNWFKRRASKFMTLVASQFASSYVFYWRDYFEDQPLLYPPGFDGR 159
            .|||:||||||||||||||.:..||||::|.:|.|.|.|:||||..|..:. :.||.|.|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

  Rat   160 VVLYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQQRLKGTLTADKNEILFSEF 224
            ||||||.|.|||||||||||.|:||||||.||.|:.:.|||..||:.:|:||.:|||||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

  Rat   225 HINYNNEPHMYRKGTVLVWQKVNEVRTQEIRLPAEMEGEKMAVTRTRTKLVALNCDLIGDAFWKE 289
            .|||||.|.||||||:|:.::|             :.|||     :|..:|.|:.|||...||||
  Fly   195 GINYNNLPAMYRKGTILLRKRV-------------ILGEK-----SRQAVVPLHEDLISSQFWKE 241

  Rat   290 HPEIL 294
            |.|||
  Fly   242 HTEIL 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Thg1lNP_001013988.1 Thg1 31..291 CDD:226508 146/260 (56%)
Thg1 38..164 CDD:282322 72/126 (57%)
Thg1C 167..282 CDD:291110 61/115 (53%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 142/256 (55%)
Thg1 9..134 CDD:282322 72/126 (57%)
Thg1C 137..234 CDD:291110 61/115 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165991168
eggNOG 1 0.900 E1_COG4021
Hieranoid 1 1.000
Homologene 1 1.000 H5959
Inparanoid 1 1.050 301 1.000 Inparanoid score I2553
OMA 1 1.010
OrthoDB 1 1.010 D1152974at2759
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 1 1.000 T1087214
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 LDO PTHR12729
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.