DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp10b and CG33298

Sequence 1:XP_008765859.2 Gene:Atp10b RGDID:1565126 Length:1472 Species:Rattus norvegicus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1412 Identity:556/1413 (39%)
Similarity:810/1413 (57%) Gaps:194/1413 (14%)


  Rat    15 RSQNGFSQSPSETTP------LLSPETGRQSYNPTEQRVVYPNNSMCHQDWKK--VSRRYPGNSI 71
            ||::.::...:|..|      |.:..|| ..:.....|.|.||:::..:..|:  .:.::.||.|
  Fly   192 RSESIYTLRRTEAPPWWKRLTLCNYNTG-DKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKI 255

  Rat    72 CTTKYTLLTFLPQNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITMLPLAIVLLVIMVKDGTE 136
            .|||||||:|:|:||.|||||.|||||:|:|:|||:|.:..|.:|:.|:|:..||.|..|||..|
  Fly   256 RTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFE 320

  Rat   137 DFKRYCFDREMNSASIQIYERKEQSYMQKRWQDVRVGDFVQMRCNEIVPADILLLFSSDPSGVCH 201
            |.:|...|:.:|:.:.::|:.:.:.|.:.:||::||||.|.:..||.||||||||.:|||.|||:
  Fly   321 DRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCY 385

  Rat   202 LETANLDGETNLKQRRVVKGFSQQEVQFQPEHFHSTIVCEKPNNHLSKFKGYMEHPDETRTGFGS 266
            ::|.:||||||||:|.||:||.:.:..|.|..|.|.:..:.|...|.:|.|.:.||...|....:
  Fly   386 IDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPIST 450

  Rat   267 ESLLLRGCTIRNTEVAAGIVIYAGHETKAMLNNSGPRYKRSKIERRINTDIFFCIGLLFLMCLIG 331
            |.||||...::||:...|||:|||||||:||||||||||||::|:::|.|:.:|:.:|.::|::|
  Fly   451 ECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVG 515

  Rat   332 AVGHSLWNGTFKEHPPFDVPDADGNFLSPALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVF 396
            |:|..:|..:|...|   ||....|.|:..:...::|.|.|::|||:||:||||:|||.|:.|||
  Fly   516 AIGCRMWLSSFTHFP---VPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVF 577

  Rat   397 LLHNDLDLYDEETDLSIQCRALNITEDLGQIQYIFSDKTGTLTENKMVFRRCTIVGNEYCHQENA 461
            .:||::||:|.||:...:|||:||||:|||||:||:|||||||||||:||||.:.|::|.|.   
  Fly   578 HIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHP--- 639

  Rat   462 KRLEMPKELDSDGEEWTQYQCLSFPPRWTQGPATIRSQGGAQPLRRCHSARVPIQSHSRQRSVGR 526
                 |.||:.                       |.|:.||                        
  Fly   640 -----PSELEK-----------------------IYSKPGA------------------------ 652

  Rat   527 WETSQPPVAFSSSIEKDVTPDKNLLSKVRDAALWLETLDTRPAKPSHSTTASIADFFLALTICNS 591
               ..||          :.|:.||.|.:  |.|...|..|..|:       .|.:|.:.|.|||:
  Fly   653 ---PAPP----------LIPNDNLNSDM--AQLTQGTYLTPHAQ-------RIQEFLVVLAICNT 695

  Rat   592 VMVSTTTEPRKRVTTPPA---NKALGTSLEKIQHLFQRLKLLSLSQSFSSTAPSDTDL-GESLGP 652
            |:|...  |.:.:.....   .:.:|.|...::|..||.|||:   |.:||..:.|.: |.:..|
  Fly   696 VIVGAA--PHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLA---SSTSTTTTTTIINGPTTQP 755

  Rat   653 NVPTIDADE----KDDASVCSGD------CSTDGGYR------SSTWEQGDNLGSESG------- 694
            .|.:|.||.    .:..||....      ......::      ||:.|...|..|||.       
  Fly   756 QVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNK 820

  Rat   695 --------------------TSLEEGLEAPA----------------LSLDGPELCYEAESPDEA 723
                                ||:...|.|..                .:.||..| ||||||||.
  Fly   821 SLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPL-YEAESPDEL 884

  Rat   724 ALVHAARAYSFTLVSRTPEQVTVRLPQ-GICLTFDLLFTLGFDSVRKRMSVVVRHPLTGEIVVYT 787
            |||:||.:|...|::|:|.|:.|.:|. |....:::|..|.|||.||.||:|||...:.|||:||
  Fly   885 ALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYT 949

  Rat   788 KGADSVIMDLLEDPACGNDIDVEKKLKRIRARTQKHLDLYARDGLRTLCIAKKVVNEEDFQRWAS 852
            |||||.||.:|. |...|..:     ..:|.:||:.||.|||:|||.|.:||:.:|..|:..|.:
  Fly   950 KGADSSIMPVLV-PCSHNSPE-----GILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWA 1008

  Rat   853 FRREAEASLDNREELLMETAQHLENRLTLLGATGIEDRLQEGVPDTIAALREAGIQLWVLTGDKQ 917
            ..:|.|.||:|||..|.::...||:.||||||||||||||:|||:|||:|..|||.:|||||||.
  Fly  1009 RHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKP 1073

  Rat   918 ETAVNVAHSCKLLDQADTVYSINTENQETCESILNCALEDVKRFHEPQQPARKLCGYCIPSKKPS 982
            |||:|:|:|.||..|...:..:...:::..|:.:|..|.|::     ........||....:|  
  Fly  1074 ETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDME-----NDKTTSTLGYGQSLRK-- 1131

  Rat   983 VNLGAMAPEIGLVIDGKTLNAIF--QGKLENKFLELTQYCRSVLCCRSTPLQKSMIVKLVRDKLS 1045
                   .:..||:|||||..|.  :.||...||.|::.|.||||||||||||:.:||:|:::|:
  Fly  1132 -------KQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELN 1189

  Rat  1046 VMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVMSSDFAIARFSHLKKLLLVHGHWCYSRLARM 1110
            :.||:||||||||||||.||:|:||||||||||||::||.:.||.:|::|||.||:|||.||:||
  Fly  1190 LRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRM 1254

  Rat  1111 VVYYFYKNVCYVNLLFWYQFFCGFSGSTMIDYWQMIFFNLFFTSLPPIVFGILDKDVSAETLLAL 1175
            ::|:||||..:|.|:||||.:|||||..|:|...::.:||.||||||:..|:.||.|:.:.||..
  Fly  1255 ILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKN 1319

  Rat  1176 PELYKSGQNSECYNLPTFWVSMADAFYQSLICFFIPYLTYRGSDIDVFTFGTPINTISLTTILLH 1240
            |.|||:|:....|....||:.:.||.||||:.||:....|..||:.::.|||.|....|...|:|
  Fly  1320 PYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVH 1384

  Rat  1241 QAMEMKTWTVLHGLVLLGSFLMYFVVSLIYNATCVTCNSPTNPYWLMERQLSDPMFYLTCLLTPV 1305
            .|:|:::|||||.|.::.|...:::.:::|::.|:.|....:.||::....:..:.:|..:|:.|
  Fly  1385 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTV 1449

  Rat  1306 VALLPRYFLLSLQGTYGKSLISKAQKIDKLPIDKRNLEIQNWRSKQR 1352
            ||:|||..|.::             :|...|.|...:.:|:.|.:.|
  Fly  1450 VAVLPRLLLTTV-------------RISLCPDDSTKVILQSKRERSR 1483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp10bXP_008765859.2 None
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 31/50 (62%)
ATPase-Plipid 250..1473 CDD:273734 541/1342 (40%)
E1-E2_ATPase 302..>394 CDD:278548 42/92 (46%)
Cation_ATPase <880..965 CDD:289987 43/86 (50%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 102/258 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1020 1.000 Inparanoid score I257
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T618185
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
1110.840

Return to query results.
Submit another query.