DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tbx16 and byn

Sequence 1:NP_571133.1 Gene:tbx16 ZFINID:ZDB-GENE-990615-5 Length:470 Species:Danio rerio
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:517 Identity:157/518 (30%)
Similarity:226/518 (44%) Gaps:154/518 (30%)


Zfish    21 GAGDSYH-QGNIRMTLEDPELWRSFHEIGTEMIITKPGRRMFPHCKISLSGLVPYAKYILLVDMV 84
            |||.... ..|:|::|:|.|||..|..:..|||:||.||||||..|||.|||.|.|.|.:|::.|
  Fly    76 GAGSPNELDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFV 140

Zfish    85 PEDGLRYKWNKDKWEVAGKAEPQPPYRTYLHPDSPAPGSHWMKQPVSFLKLKLTNNALDQHGHII 149
            ..|..|:|:...:|...||||..|....|:||:||..|:||||:|:||.|:||||.. :.:|.|:
  Fly   141 QIDSHRWKYVNGEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNKT-NGNGQIM 204

Zfish   150 LHSMHRYHPRFHIVQ--ADDLYSVRWSVFQTFTFPETSFTAVTAYQNTKITKLKIDHNPFAKGFR 212
            |:|:|:|.||.|:|:  ::..:.|      |:.||||.|.|||||||.::|.|||.:|||||.|.
  Fly   205 LNSLHKYEPRVHLVRVGSEQRHVV------TYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFL 263

Zfish   213 DEGTNSKRRANR----------NLPDPER---------VAKKMSKDSEHG---------SPQDVQ 249
            |    :|.|.:.          .:|.|..         ....:|....||         |.:.|.
  Fly   264 D----AKERPDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVG 324

Zfish   250 PSSCEALDDEHAGRKELEVKAERYSPWGGACDRDSGHALRPESPLGSDHRDVYSSEQLVPGQNTY 314
            |||                        ||:||| .|.:|              ||..:.|.:.| 
  Fly   325 PSS------------------------GGSCDR-YGRSL--------------SSRSVAPTRTT- 349

Zfish   315 QPYRFHEYGKSPSPSSSSSVGGSSACGSAGRPSFESRVLDVATVPDTDSSSKPSSAPEFSLPPHP 379
             ||           |....|.||.:.||||..|              .:|.:|.|||:     .|
  Fly   350 -PY-----------SRPRVVSGSGSNGSAGNAS--------------STSPQPPSAPQ-----TP 383

Zfish   380 SAGHQEYAGVLNMAITQAKPGMLGTHP------------------------LYSHYSTEQSLGQW 420
            ::.|....|.::.:::.:..|.:|:.|                        ::|:.|:.||.|.:
  Fly   384 TSLHSTSTGSVSTSVSSSSGGGIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQSNGNY 448

Zfish   421 SGAAASQYPPP--------------PPPHHHLP---TEYSSQAVHHGYHHGNVGDWSQYPLF 465
            ..|.:...|.|              |.|.:..|   |...|..:||...|.:..:.:|..::
  Fly   449 WNATSVPGPMPMNVCSGRNISSHNSPSPTNGSPSYTTSSPSYTIHHLTPHSHQYNMAQTDIY 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tbx16NP_571133.1 TBOX 30..217 CDD:238106 92/189 (49%)
bynNP_524031.2 TBOX 86..268 CDD:238106 93/193 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.