DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnn and Ten-m

Sequence 1:XP_005171321.1 Gene:tnn ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio
Sequence 2:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster

Alignment Length:1184 Identity:237/1185 (20%)
Similarity:374/1185 (32%) Gaps:454/1185 (38%)


Zfish   119 CAQGCC---KGGAGVDTS------------CSGHGTYQQDSCSCKCNPGWEGPDCSISSCPDECN 168
            ||.|.|   ||..|.|.:            ||||||:..|:.:|.|...|.|.|||...|..:|.
  Fly  1178 CADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCG 1242

Zfish   169 DNGRCVDGRCVCYEGYTGHDCSQLTCPNDCKDKGHCVDGKCVCFSGFSGEDCSIATCPNDCIGNG 233
            .:|||....|.|...:.|..|:...|...|.:.|.|.:|.|:|.:|::|:.|:|..|||.|.|:|
  Fly  1243 QHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHG 1307

Zfish   234 RC-VDG----QCICDEGFFGIDCSMVL----GPKGLRLIKVTDVSLLVEWESVRGAEYYILSYHP 289
            :| |.|    :|.|.||:.|.||.:.|    |..     |..|...||:.|.......::.    
  Fly  1308 QCRVSGEGQWECRCYEGWDGPDCGIALELNCGDS-----KDNDKDGLVDCEDPECCASHVC---- 1363

Zfish   290 KGNK---GAIKEVQVENTKNSYLITGLKPGVT--------YIV-----QVYAVIRGIN------- 331
            |.::   .|.|.:.|       |:....|.:|        :::     |.||.:...|       
  Fly  1364 KTSQLCVSAPKPIDV-------LLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNESIFWNY 1421

Zfish   332 ---SESDQITATTEVS---GIEGIKVLSQT---------EDS----------------------- 358
               |.|..|......|   |:.|::|.:.|         :|.                       
  Fly  1422 FNASRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFRP 1486

Zfish   359 ----IQVDWKNPGIIVDYFKLTHASHDGQG--------GHENVVMSQE--ARTKHTIVGLNPGTE 409
                :||.| |..:|:|...::.:...|..        .|:..:|...  |..||...|..|   
  Fly  1487 QSRIVQVPW-NEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGACP--- 1547

Zfish   410 YQIGVQAIKGENEGKASFATGVTDIDAPTNLATREVTENSATVTWDGVRAEIDGYMLTY--SSAE 472
                                     |....||..:|.:.|..:...|:.       |.|  |.|.
  Fly  1548 -------------------------DRSAILAESQVIQESLQIPGTGLN-------LVYHSSRAA 1580

Zfish   473 GTSREIKVAAG----ATSYQLTSLK---------------PGVLYTVFLWAYKGSRSSRKSMTEA 518
            |....||:...    .||..|..|:               ||:.:|   :|:......|:.:...
  Fly  1581 GYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFT---YAWNRLNIYRQRVYGV 1642

Zfish   519 ETDIDAPTNLMTREVTEDSASVTWNKVQADIDGYMLKYSSLDGSGQEVRVGADSTSYRFTGLKPG 583
            .|.:.......|     |...:.|:.....:.|:.:..|.:.|...::.       :|: ....|
  Fly  1643 TTAVVKVGYQYT-----DCTDIVWDIQTTKLSGHDMSISEVGGWNLDIH-------HRY-NFHEG 1694

Zfish   584 VLYTVYVWAIKGARSSKKSSTEAETDIDAPTNLLTQ---------EVTEDSASVTWNKVQADI-- 637
            :|.       ||..|:.....:       |..:||.         |..:.....|..::.|.:  
  Fly  1695 ILQ-------KGDGSNIYLRNK-------PRIILTTMGDGHQRPLECPDCDGQATKQRLLAPVAL 1745

Zfish   638 ----DGYM-------LKYSSLDGSGQE-VRVGADSISYRF-TGLKP--GVLYT--------VSV- 678
                ||.:       ::....|||.:. |::.|..:|||: ..|.|  |.||.        :.| 
  Fly  1746 AAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVR 1810

Zfish   679 -----------W-AVKGSRSSRKATTEA---------ETEIDAPK----------------NLKA 706
                       | ||.||........||         :.::..||                |::.
  Fly  1811 DTNDYSQPELNWEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRM 1875

Zfish   707 TDVQTQTSTLT--------WK-----------------------APQAN----IEGYILTYRAED 736
            .|.....|||.        ||                       :|..|    |:.:::.....|
  Fly  1876 VDRDGIVSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPD 1940

Zfish   737 GSMQTV--------------------EKTL--------------------TARENRFALSG---- 757
            |.::.:                    ..||                    :.|.||..:.|    
  Fly  1941 GRVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGR 2005

Zfish   758 -------------LEMG------KKYIVTL------------------IAYRGSKRSKIVETTFS 785
                         ||.|      :.|:.|.                  ||.:.:.|.:.|.::..
  Fly  2006 IAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIP 2070

Zfish   786 TVGLAYQFPM---DCTQI---------MRNGNMESG----VYTIYVNNNRSRTMQVYCDMKTDGG 834
            ....:.::.:   |..:|         :...|:.:|    |:|..||.:..:...|     ||..
  Fly  2071 EASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTV-----TDAA 2130

Zfish   835 GWIVFQRRN-TGKVDFMKKWRDYMKGFGELTEEFWLGLDKIHELTNTPTQYEARFDLG------- 891
            |..||..|: |.:|:.::..:      |:........:..:||| :||..|...::..       
  Fly  2131 GNKVFLLRDYTSQVNSIENTK------GQKCRLRMTRMKMLHEL-STPDNYNVTYEYHGPTGLLR 2188

Zfish   892 ---SGSDRKYAV-YDNF-----KVAPSKQKFKLTIG-SYKG-------NA---------GDAMTY 930
               ..:.|.|.. ||.|     .|.|:.:..:|:.. |.||       ||         |..:..
  Fly  2189 TKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQGATVIV 2253

Zfish   931 HQGAPFS--TVDSD 942
            ..||..|  |||.|
  Fly  2254 RNGAAESRTTVDMD 2267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688 14/42 (33%)
EGF_2 161..189 CDD:285248 8/28 (29%)
EGF_2 193..220 CDD:285248 9/27 (33%)
EGF_2 224..251 CDD:285248 15/32 (47%)
fn3 257..333 CDD:278470 17/102 (17%)
fn3 344..426 CDD:278470 20/131 (15%)
fn3 435..514 CDD:278470 22/100 (22%)
fn3 523..602 CDD:278470 12/79 (15%)
fn3 611..683 CDD:278470 25/119 (21%)
fn3 699..773 CDD:278470 27/206 (13%)
FReD 792..1003 CDD:238040 45/204 (22%)
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 8/20 (40%)
CRD2 1106..1151 CDD:276900
EGF_2 1139..1162 CDD:285248
Keratin_B2 1162..1330 CDD:279797 57/152 (38%)
EGF_2 1167..1194 CDD:285248 8/16 (50%)
DUF3844 1171..>1235 CDD:289707 22/57 (39%)
EGF_2 <1272..1294 CDD:285248 8/22 (36%)
NHL 1750..2065 CDD:302697 51/315 (16%)
NHL repeat 1784..1830 CDD:271320 12/46 (26%)
NHL repeat 1854..1888 CDD:271320 7/34 (21%)
NHL repeat 1911..1950 CDD:271320 5/39 (13%)
NHL repeat 1972..2005 CDD:271320 4/33 (12%)
NHL repeat 2039..2065 CDD:271320 3/26 (12%)
RHS_repeat 2183..2218 CDD:283287 7/35 (20%)
RhsA 2347..3020 CDD:225750
YD_repeat_2x 2795..2836 CDD:273728
Rhs_assc_core 2905..2980 CDD:274730
Tox-GHH 3193..3268 CDD:292269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.