DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: flt4 and drpr

Sequence 1:NP_571020.2 Gene:flt4 ZFINID:ZDB-GENE-980526-326 Length:1368 Species:Danio rerio
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:242 Identity:53/243 (22%)
Similarity:84/243 (35%) Gaps:76/243 (31%)


Zfish   257 DSPVELMQGESLVLNCTALVDFNTGVDFQWDYPGKKENRLASLQPLRNVLDEATEISSILSIRNI 321
            |:||..||.|:.:|                  |....:::       |..|:.:.:|:...    
  Fly   854 DNPVYGMQAETRLL------------------PNNMRSKM-------NNFDQRSTMSTDYG---- 889

Zfish   322 HLDDS------GYYTCWAN----TLEMKRELTTVVIVHEKPFISLDYRN-GSVIEAKEGQKS-VR 374
              ||.      |.|:...|    |..:..:.|..::.:|    ||...: ...|:.|||.|. |:
  Fly   890 --DDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNE----SLKEEHVYDEIKHKEGYKDPVK 948

Zfish   375 LSVKVSAYPSPEIQWYKNGKLISSKNSSRFKVQQHSLQIRDVCKQDAGEYMLVLKNSPAALEKRL 439
            :..|: .:|..|..     .|..|:.|:..|...|.:       .||   ||.:...........
  Fly   949 IYSKI-LFPEDEYD-----HLDYSRPSTSQKPHYHRM-------NDA---MLNINQDEEKPSNVK 997

Zfish   440 NFTLIVNVP-------PQIHEKEAAPPTNLYGKGTRQILTCTADGSP 479
            |.|:::|.|       || ||......|||     ..:.|.:...||
  Fly   998 NMTVLLNKPLPPTEPEPQ-HECFDNTNTNL-----DNVSTASPSSSP 1038

Known Domains:


GeneSequenceDomainRegion External IDIdentity
flt4NP_571020.2 IG_like 258..348 CDD:214653 17/100 (17%)
Ig1_VEGFR 265..350 CDD:143270 13/95 (14%)
IG_like 362..445 CDD:214653 20/84 (24%)
Ig 373..445 CDD:299845 15/72 (21%)
Ig 602..685 CDD:143165
IG 602..678 CDD:214652
I-set 705..786 CDD:254352
IGc2 714..776 CDD:197706
PKc_like 858..1184 CDD:304357
Pkinase_Tyr 866..1177 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.