DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tnc and Ten-m

Sequence 1:NP_001299845.1 Gene:tnc ZFINID:ZDB-GENE-980526-104 Length:1811 Species:Danio rerio
Sequence 2:NP_001262211.1 Gene:Ten-m FlyBaseID:FBgn0004449 Length:3349 Species:Drosophila melanogaster

Alignment Length:1773 Identity:390/1774 (22%)
Similarity:593/1774 (33%) Gaps:595/1774 (34%)


Zfish   287 CPNDCFDRGRCENGTCYCDEGFTGEDCGELTCPQNCNHHGRCVNGQCICNIGYSGEDCSKL--TC 349
            |||.|...|:|..|.|.|:.||.|:||.|..||..|:.||...||:||||.|:.|::||..  .|
  Fly  1071 CPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDEC 1135

Zfish   350 -LNDCSERGHCFNGKCICDPGFEGEDCSLLSCP-DNCNGRGHCVNGECICGPGYEGDDCS----- 407
             :.|||..|||.:|||.|..|::|:.|..:.|| .||:|.|.|.:|.|||..|::|.||:     
  Fly  1136 EVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPDCATMDQD 1200

Zfish   408 ELSCLNNCHDRGR--CVNGKCICKAGFAGEDCSIKTCPHDCHGRGECVDGKCVCHDGFAGEHCGI 470
            .|.||.:|...|.  .....|.|:|.::|:|||.:.|..||...|.|....|.|...:.||:|..
  Fly  1201 ALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNT 1265

Zfish   471 KTCPHHCHGHGQCVDGKCICHKGFAGEDCSIKTCPNHCHGQGQC-IDG----KCICHDGFAGEDC 530
            :.|...|:.||||.:|.|:|..|:.|:.|:|:.|||.|.|.||| :.|    :|.|::|:.|.||
  Fly  1266 RLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDC 1330

Zfish   531 SIKTCPNHCHGRGRCVDGKCICHDGFAGEDCNIKTCPNDCHDHGECVDGKCICHAGFTGHDCSEL 595
            .|....|       |.|.|....||..           ||.| .||    |..|...|...|...
  Fly  1331 GIALELN-------CGDSKDNDKDGLV-----------DCED-PEC----CASHVCKTSQLCVSA 1372

Zfish   596 TCPNDC---------------------------------------------HNRGRCVNGQCVCN 615
            ..|.|.                                             .:|...:.|:.|.:
  Fly  1373 PKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNESIFWNYFNASRSAVIRGRVVTS 1437

Zfish   616 I--GFTGEDCGTKTCPNNCLDRGFCEDGKCVCFEGYTGEDCSVLTCPADCNDQG---QCLNGMCI 675
            :  |..|....|.|                 ..||:|      ||     .|.|   ..:||...
  Fly  1438 LGMGLVGVRVSTTT-----------------LLEGFT------LT-----RDDGWFDLMVNGGGA 1474

Zfish   676 CDLGFTGDDCSEISPPRDLTVTEVDPET--VDVAWVNEMLVTEYLITYVPTAPGGLEMEMRVSGE 738
            ..|.|..      :|.|        |::  |.|.| ||:::.:.::             |.:|.|
  Fly  1475 VTLQFGR------APFR--------PQSRIVQVPW-NEVVIIDLVV-------------MSMSEE 1511

Zfish   739 K------------------KTATIRELEPGIE-------YLISVFAVLNSKMSVP--------VS 770
            |                  |...:...:.|.:       .:::...|:...:.:|        .|
  Fly  1512 KGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHS 1576

Zfish   771 ARIATHL--------PEP--------------EGLKFKSVKETSVEVE----WDPLNI------- 802
            :|.|.:|        |:.              ||:.|:.:.|....::    |:.|||       
  Fly  1577 SRAAGYLSTIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYG 1641

Zfish   803 -----------------------------------PFDGWNLIFRNTKEEDGEILNSLAPPETTF 832
                                               ...||||...:.......||          
  Fly  1642 VTTAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGIL---------- 1696

Zfish   833 EQSGLGPGQEYEVKLEVVKNNTRGPPASKNVVTMIDAPSQ-VDVRDVTDTTALVTWLQPVAQV-- 894
             |.|.|.......|..::            :.||.|...: ::..|..........|.|||..  
  Fly  1697 -QKGDGSNIYLRNKPRII------------LTTMGDGHQRPLECPDCDGQATKQRLLAPVALAAA 1748

Zfish   895 -DGISVSYGP-------NTDSSDRNTIELSS--IETQYHLAELSP--------DTEYEVSLMARR 941
             || |:..|.       .||.|.|..::|::  :..:||:| |||        |.|....:..|.
  Fly  1749 PDG-SLFVGDFNYIRRIMTDGSIRTVVKLNATRVSYRYHMA-LSPLDGTLYVSDPESHQIIRVRD 1811

Zfish   942 GEMSSFPIYETFTTDLDSPKHLKAIEQTDESITLEWRNSRANVLNYRVKYGP----LSGGE---- 998
                        |.|...|:                       ||:....|.    |.|.|    
  Fly  1812 ------------TNDYSQPE-----------------------LNWEAVVGSGERCLPGDEAHCG 1841

Zfish   999 ------HGELVFPSGLQDTTQAKITGLRPGTEYGM----GVTSI-------KEERESLPATTNAV 1046
                  ..:|.:|.|:..::. .|.....||...|    |:.|.       |...:.:|......
  Fly  1842 DGALAKDAKLAYPKGIAISSD-NILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGTLK 1905

Zfish  1047 TD---LDPPKDLQVSETTETTLALVWRRPVAKIDTYSLVFIPADGDKTELKIPGAANTYILTGLN 1108
            .:   |..|.:|.|| ..:.||.:        ||.:.::.:..||           ...:::| .
  Fly  1906 LEEMHLRWPTELAVS-PMDNTLHI--------IDDHMILRMTPDG-----------RVRVISG-R 1949

Zfish  1109 PGMLHTITLTAERGRKMSAPATLSASTDEEKPQVGNITISDVSWDSFSMSWDLDRGEVEGFLIEV 1173
            |  ||..|.:......::..|||..........:|.:.:::      |.|..::|..|.|     
  Fly  1950 P--LHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAE------SDSQRINRVRVIG----- 2001

Zfish  1174 SDPDGLSDGQNHTLSGQEFSLAVTDLSPSTF----YRVTLYGLYKGELLDPVFAEAITEAEPEVE 1234
                  :||:....:|.|......:.....|    |..|      ....:.:.|.|:|   |: .
  Fly  2002 ------TDGRIAPFAGAESKCNCLERGCDCFEAEHYLAT------SAKFNTIAALAVT---PD-S 2050

Zfish  1235 HITVSDITPHSFK-VTWTAPEA-----------------VFDSFALKVLDSSGLGRPHQISVSGD 1281
            |:.::|...:..: |..:.|||                 :|:.|...|                 
  Fly  2051 HVHIADQANYRIRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHV----------------- 2098

Zfish  1282 KRTEAVTGLNEDTDYEIELFGIILGRKFQPIFTVARTGLGTPKGIRFSDVTDTSATVHWTMPHTR 1346
            .....:||   :|.|               :||.   .:.|..| :.|.|||.:           
  Fly  2099 STRNILTG---ETTY---------------VFTY---NVNTSNG-KLSTVTDAA----------- 2130

Zfish  1347 VDNYRVIYVPIQGGSPLTLRVDGGESQAMLSNLTPGVTYQVTVIAVKGLEE-SEPGSERVTTALD 1410
                         |:.:.|..|.......:.| |.|...::.:..:|.|.| |.|.:..||....
  Fly  2131 -------------GNKVFLLRDYTSQVNSIEN-TKGQKCRLRMTRMKMLHELSTPDNYNVTYEYH 2181

Zfish  1411 KPRGLTAVNISDTEALLLWQ-------PSIATVDGYVITYSAD-SVAPVMERVSGNTVEFEMSSL 1467
            .|.||....:..|....::.       .|..|..|.||..|.| ||.....:||.| .:.|||.|
  Fly  2182 GPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSEN-AQKEMSLL 2245

Zfish  1468 TPATLYTVKVYAFRDTAKSAATSTDFTTDVDAPQNLAASNIQTETAMLTWKPPRADISGYILSFE 1532
            .......|         ::.|..:..|.|:|.          :.|::..|        |:.|..|
  Fly  2246 IQGATVIV---------RNGAAESRTTVDMDG----------STTSITPW--------GHNLQME 2283

Zfish  1533 SADGVVKEVVLSPTATFYSMSQLTASTEYTVKLQAIAGPKRSRVISTVF------LTIGVLYKHP 1591
                |....:|:..:.....|....:.:.|    .|||...:|.....|      |..|...|.|
  Fly  2284 ----VAPYTILAEQSPLLGESYPVPAKQRT----EIAGDLANRFEWRYFVRRQQPLQAGKQSKGP 2340

Zfish  1592 ----KDCSQAL-LNGDTTSGL------YTIYLRGDESQPLQVYCDMTTDGGGWIVFVRRQSG--- 1642
                .:..:.| :|||....|      .::.:..|:.|.|   .::|.|.....:..|.|||   
  Fly  2341 PRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQEL---LNVTYDRTSRPISFRPQSGDYA 2402

Zfish  1643 --KVEFFR-----NWK----NYTAGF---GDLND-EFWLGLSNLHKITS-FGQYELRVDLRDKGE 1691
              .:|:.|     :||    .....|   |.||: ::..|.:.::.... ||...|:|....:.:
  Fly  2403 DVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSD 2467

Zfish  1692 SAYAQYDKF----SISEPRARYKVHVGGYS-GTAGDSMTYHH-----GRPFSTYDNDND--IAVT 1744
             ...|||..    |::.||.    |:..:| .|:.....|.:     ..||....||..  :|..
  Fly  2468 -YLLQYDDAGALQSLTTPRG----HIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKI 2527

Zfish  1745 NCALSYKGAFWYKNCHRV 1762
            :...|.|.||.:....|:
  Fly  2528 HPHQSGKVAFVHDTAGRL 2545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tncNP_001299845.1 DnaJ <471..>544 CDD:333066 30/78 (38%)
fn3 689..760 CDD:306538 14/98 (14%)
fn3 778..858 CDD:306538 19/140 (14%)
fn3 868..948 CDD:306538 24/101 (24%)
FN3 958..1047 CDD:238020 18/114 (16%)
fn3 1050..1128 CDD:306538 15/78 (19%)
fn3 1140..1215 CDD:306538 13/79 (16%)
fn3 1231..1303 CDD:306538 14/90 (16%)
fn3 1323..1400 CDD:306538 15/78 (19%)
fn3 1410..1482 CDD:306538 21/80 (26%)
fn3 1498..1570 CDD:306538 12/72 (17%)
FReD 1589..1798 CDD:238040 49/217 (23%)
Ten-mNP_001262211.1 TNFRSF 1069..1198 CDD:304602 59/127 (46%)
CRD2 1106..1151 CDD:276900 22/45 (49%)
EGF_2 1139..1162 CDD:285248 12/23 (52%)
Keratin_B2 1162..1330 CDD:279797 65/168 (39%)
EGF_2 1167..1194 CDD:285248 14/27 (52%)
DUF3844 1171..>1235 CDD:289707 25/64 (39%)
EGF_2 <1272..1294 CDD:285248 10/22 (45%)
NHL 1750..2065 CDD:302697 76/403 (19%)
NHL repeat 1784..1830 CDD:271320 15/82 (18%)
NHL repeat 1854..1888 CDD:271320 8/35 (23%)
NHL repeat 1911..1950 CDD:271320 12/60 (20%)
NHL repeat 1972..2005 CDD:271320 8/50 (16%)
NHL repeat 2039..2065 CDD:271320 6/30 (20%)
RHS_repeat 2183..2218 CDD:283287 7/35 (20%)
RhsA 2347..3020 CDD:225750 47/208 (23%)
YD_repeat_2x 2795..2836 CDD:273728
Rhs_assc_core 2905..2980 CDD:274730
Tox-GHH 3193..3268 CDD:292269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.