DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and DSK2

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_014003.1 Gene:DSK2 / 855319 SGDID:S000004889 Length:373 Species:Saccharomyces cerevisiae

Alignment Length:609 Identity:136/610 (22%)
Similarity:211/610 (35%) Gaps:264/610 (43%)


Human    33 IKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLT 97
            :.:.:|:.::|.|..|...|:|.||||||:|..........||::||||||..|:..:.|.||.:
Yeast     3 LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHS 67

Human    98 VHLVIKSQNRPQGQSTQPSNAAGTN--TTSASTPRSNSTPISTNSNPFGLGSL--------GGLA 152
            |||| |||.:|     |.::|||.|  |.:.:...:.:||..::....|...|        .|..
Yeast    68 VHLV-KSQPKP-----QTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSARYAGYL 126

Human   153 GLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQS----MLSNPDLMRQLIMANPQMQ- 212
            .:.|..:...:...|.:....|     :.::::||||..||    |||||.::..:|.:|||:| 
Yeast   127 NMPSADMFGPDGGALNNDSNNQ-----DELLRMMENPIFQSQMNEMLSNPQMLDFMIQSNPQLQA 186

Human   213 ------QLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRM 271
                  |::| :|....:|.|||::||:::.||       ||                       
Yeast   187 MGPQARQMLQ-SPMFRQMLTNPDMIRQSMQFAR-------MM----------------------- 220

Human   272 YTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTT 336
                              :|.|.:||:..:...           .|.|....|...|:..|::::
Yeast   221 ------------------DPNAGMGSAGGAASA-----------FPAPGGDAPEEGSNTNTTSSS 256

Human   337 STGSGSG-NSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLS 400
            :||:.:| |:.:||..||  |||..||:.              ||.|                  
Yeast   257 NTGNNAGTNAGTNAGANT--AANPFASLL--------------NPAL------------------ 287

Human   401 QNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTL 465
                        :|...|.......|    |||     :|..|::|..|                
Yeast   288 ------------NPFANAGNAASTGM----PAF-----DPALLASMFQP---------------- 315

Human   466 ATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGS 530
                                        ||                                   
Yeast   316 ----------------------------PV----------------------------------- 317

Human   531 GGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFL 595
                     .|:.:|.|.|                            ||.|::.||.|||.|||.
Yeast   318 ---------QASQAEDTRP----------------------------PEERYEHQLRQLNDMGFF 345

Human   596 NREANLQALIATGGDINAAIERLL 619
            :.:.|:.||..:||.:..|::.||
Yeast   346 DFDRNVAALRRSGGSVQGALDSLL 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 29/70 (41%)
hPLIC_N 33..103 CDD:176403 29/70 (41%)
STI1 382..426 CDD:128966 3/44 (7%)
12 X 3 AA tandem repeats of P-X-X 491..526 2/35 (6%)
UBA_PLICs 581..620 CDD:270582 17/40 (43%)
DSK2NP_014003.1 Scythe_N 3..73 CDD:176404 30/71 (42%)
STI1 149..185 CDD:128966 15/36 (42%)
UBA_Dsk2p_like 328..369 CDD:270509 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63757835
eggNOG 1 0.900 E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1493
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T2533384
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 O PTHR10677
Phylome 1 0.910 0.818 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.