DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and Ubqln2

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_061268.2 Gene:Ubqln2 / 54609 MGIID:1860283 Length:638 Species:Mus musculus

Alignment Length:641 Identity:559/642 (87%)
Similarity:597/642 (93%) Gaps:20/642 (3%)


Human     1 MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRF 65
            ||||||||||||||||||||.|:|:.||||||||||||||||||||||||||:||||||||||||
Mouse     1 MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRF 65

Human    66 KSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQ-STQPSNAAGTNTTSAST- 128
            ||||||||||||||||||||||:||||||||||||||||||||||| :||||..|||:||:.:| 
Mouse    66 KSQTDQLVLIFAGKILKDQDTLMQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTAGTSTTTTTTT 130

Human   129 ------------PRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEM 181
                        |||:|||.:|||:.|||||   |:.||:|||:|.||:|||:||||||:|||||
Mouse   131 TAAAPAATTSSAPRSSSTPTTTNSSSFGLGS---LSSLSNLGLNSPNFTELQNQMQQQLLASPEM 192

Human   182 MIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQE 246
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   193 MIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQE 257

Human   247 MMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTE 311
            |||||||||||||||||||||||||||||||||||||||||||||||:|||||:|||||||||||
Mouse   258 MMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFATVGSSSTSGEGTQPSRTE 322

Human   312 NRDPLPNPWAPPPATQSSATTSTTTST--GSGSGNSSSNAT-GNTVAAANYVASIFSTPGMQSLL 373
            |||||||||||||.||::|||:|||:|  |||||:|||:.| |||:|||||||||||||||||||
Mouse   323 NRDPLPNPWAPPPTTQTAATTTTTTTTSSGSGSGSSSSSTTAGNTMAAANYVASIFSTPGMQSLL 387

Human   374 QQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQ 438
            |||||||||||||||||||||||||||||||:||||||:|||||:|||||||||||||.||||||
Mouse   388 QQITENPQLIQNMLSAPYMRSMMQSLSQNPDMAAQMMLSSPLFTSNPQLQEQMRPQLPNFLQQMQ 452

Human   439 NPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGP 503
            ||:|::||||||||||||||||||||||||||||||||.||||:|||||||.|||||||||||||
Mouse   453 NPETIAAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFAPGVGMGVLGTAITPVGPVTPIGPIGP 517

Human   504 IVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALA 568
            |||||||||||||||||||:.|||||:|.|...||||:||:||.||||||||||||||||||||.
Mouse   518 IVPFTPIGPIGPIGPTGPASSPGSTGTGIPPATTVSSSAPTETISPTSESGPNQQFIQQMVQALT 582

Human   569 GANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS 624
            |.:.||.|||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   583 GGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 68/70 (97%)
hPLIC_N 33..103 CDD:176403 68/70 (97%)
STI1 382..426 CDD:128966 41/44 (93%)
12 X 3 AA tandem repeats of P-X-X 491..526 33/35 (94%)
UBA_PLICs 581..620 CDD:270582 39/39 (100%)
Ubqln2NP_061268.2 UBQ 33..103 CDD:214563 68/70 (97%)
hPLIC_N 33..103 CDD:176403 68/70 (97%)
STI1 396..440 CDD:128966 41/44 (93%)
11 X 3 AA tandem repeats P-X-X 505..537 32/32 (100%)
UBA_PLICs 595..634 CDD:270582 39/39 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156734489
eggNOG 1 0.900 E1_COG5272
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H81830
Inparanoid 1 1.050 1085 1.000 Inparanoid score I5018
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D116115at9347
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 LDO PTHR10677
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1313.270

Return to query results.
Submit another query.