DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and ubqln1

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_989221.1 Gene:ubqln1 / 394829 XenbaseID:XB-GENE-986025 Length:564 Species:Xenopus tropicalis

Alignment Length:612 Identity:426/613 (69%)
Similarity:491/613 (80%) Gaps:56/613 (9%)


Human    17 PAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKIL 81
            |:::..|::.||  :||||||||||||||||||||||:::|||.|||||||.|:|||||||||||
 Frog     5 PSSSTPSSSDPA--RIIKVTVKTPKEKEEFAVPENSSIREFKEDISKRFKSSTEQLVLIFAGKIL 67

Human    82 KDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLG 146
            ||||||.|||||||||||||||:|||.|..:...::::.|:.|:::|..|::|..:|...|.|||
 Frog    68 KDQDTLSQHGIHDGLTVHLVIKTQNRSQAATASQASSSSTSATNSTTSSSSTTTTTTTGTPLGLG 132

Human   147 SLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQM 211
            .|||||||||||::::||||||||||||||::||||:||||||||||||||||||.|||||||||
 Frog   133 GLGGLAGLSSLGMNASNFSELQSQMQQQLMSNPEMMVQIMENPFVQSMLSNPDLMSQLIMANPQM 197

Human   212 QQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQ 276
            ||||||||||||:||||||||||||:|||||||||||||||.|||||||||||||||||||||||
 Frog   198 QQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQ 262

Human   277 EPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSG 341
            ||||||||||||||||||:.|::|:. |.||||||||||||||||||.:|..|.:|.:||...| 
 Frog   263 EPMLNAAQEQFGGNPFASLVSNASNA-GNQPSRTENRDPLPNPWAPPSSTAGSTSTGSTTGANS- 325

Human   342 SGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLA 406
            :|:|::..|.:|:  .|..|.:|:|||||||:|||||||||:||||||||||||||||||||:||
 Frog   326 TGSSTTTTTSSTL--PNLGAGMFNTPGMQSLMQQITENPQLMQNMLSAPYMRSMMQSLSQNPELA 388

Human   407 AQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPG 471
            ||:|.|:|||:.|||||||||.|||.||||||||:||||||||||||||:||||||||||||||.
 Frog   389 AQVMQNNPLFSGNPQLQEQMRQQLPFFLQQMQNPETLSAMSNPRAMQALLQIQQGLQTLATEAPS 453

Human   472 LIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGP 536
            |:|...|                                 |.|.:|  .|.:.|.|         
 Frog   454 LMPRTNP---------------------------------PFGGLG--SPNSSPAS--------- 474

Human   537 TVSSAAPSETTSP---TSESGPNQQFIQQMVQALAGANAP-QLPNPEVRFQQQLEQLNAMGFLNR 597
             |.|:||:|.:||   .||.| :|||||||:|||:|||.. |.||||||||.|||||:|||||||
 Frog   475 -VPSSAPTENSSPLSGLSEPG-HQQFIQQMLQALSGANPQNQNPNPEVRFQPQLEQLSAMGFLNR 537

Human   598 EANLQALIATGGDINAAIERLLGSQPS 624
            |||||||||||||||||||||||||||
 Frog   538 EANLQALIATGGDINAAIERLLGSQPS 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 63/70 (90%)
hPLIC_N 33..103 CDD:176403 63/70 (90%)
STI1 382..426 CDD:128966 37/44 (84%)
12 X 3 AA tandem repeats of P-X-X 491..526 5/35 (14%)
UBA_PLICs 581..620 CDD:270582 37/39 (95%)
ubqln1NP_989221.1 hPLIC_N 19..89 CDD:176403 63/70 (90%)
UBA_PLICs 521..560 CDD:270582 37/39 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D145564at32523
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.