DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and Ubqn

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_001285457.1 Gene:Ubqn / 32977 FlyBaseID:FBgn0031057 Length:547 Species:Drosophila melanogaster

Alignment Length:618 Identity:285/619 (46%)
Similarity:390/619 (63%) Gaps:98/619 (16%)


Human    20 AQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQ 84
            |:|.:      |.|.|.|||||:|:...|.|:|.::.||..::::|:::.:||||||||||:||.
  Fly     2 AEGGS------KRINVVVKTPKDKKTVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDT 60

Human    85 DTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLG 149
            |||..|.|.|.||||||||:   |...:.||:.                .|......||||...|
  Fly    61 DTLQMHNIKDNLTVHLVIKA---PTRNNEQPAR----------------QPADVRQTPFGLNQFG 106

Human   150 GLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQL 214
            ||||:.:||..|..|.:||::||.:|:.:.:|:..:|:||.||.|::|||.|||||.:||||..|
  Fly   107 GLAGMEALGAGSNTFMDLQARMQNELLNNGDMLRSLMDNPMVQQMMNNPDTMRQLITSNPQMHDL 171

Human   215 IQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPM 279
            :||||||||:|||||::|||:|:||||:|:||:||:.|.|:|||||:||||:||:|:|.||||||
  Fly   172 MQRNPEISHMLNNPDLLRQTMELARNPSMLQELMRSHDRAMSNLESVPGGYSALQRIYRDIQEPM 236

Human   280 LNAAQEQFGGNPFASVGSSSSSGEGTQPSR-TENRDPLPNPWAPPPATQSSATTSTT-TSTGSGS 342
            :|||.|.||.||||.:.....||.|..|.: ||||:||||||       ..|.:.|. |..|||:
  Fly   237 MNAATESFGRNPFAGLVDGGGSGAGNNPQQGTENRNPLPNPW-------GGANSGTNGTVGGSGA 294

Human   343 GNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAA 407
            ||.:.:...|         ::.:||.|:|||||:.:||.::||:|:|||.||||:|:||:||:||
  Fly   295 GNPTGDLPPN---------NVLNTPAMRSLLQQMADNPAMMQNLLNAPYTRSMMESMSQDPDMAA 350

Human   408 QMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGL 472
            :::.:|||.:.||.||||:|..:|.|:.|||||:.::.::||.||.|::|||||::.|.:.||||
  Fly   351 RLLSSSPLMSNNPALQEQVRQMMPQFMAQMQNPEVMNMLTNPDAMNAILQIQQGMEQLRSAAPGL 415

Human   473 -----IPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGG 532
                 ||...||.|.|                                   |.||:   ..||||
  Fly   416 VGTLGIPPPPPGAGTG-----------------------------------TNPAS---GDGSGG 442

Human   533 PTGPTVSSAAPSE-------TTSPTSESGPNQQ----FIQQMVQALAGANAPQLPNPEVRFQQQL 586
            .:|.:.::.:||.       |.:.....|||.|    |:.:|:..::. ||.....||||:|.||
  Fly   443 NSGASTNNVSPSSGLNAGTGTPNLAPGGGPNAQLFNDFMMRMLNGMSN-NADNTQPPEVRYQSQL 506

Human   587 EQLNAMGFLNREANLQALIATGGDINAAIERLL 619
            ||||||||:||:|||||||||.||||||:||||
  Fly   507 EQLNAMGFVNRDANLQALIATFGDINAAVERLL 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 39/70 (56%)
hPLIC_N 33..103 CDD:176403 39/70 (56%)
STI1 382..426 CDD:128966 26/44 (59%)
12 X 3 AA tandem repeats of P-X-X 491..526 3/35 (9%)
UBA_PLICs 581..620 CDD:270582 33/40 (83%)
UbqnNP_001285457.1 UBQ 9..79 CDD:214563 39/70 (56%)
hPLIC_N 9..79 CDD:176403 39/70 (56%)
STI1 322..368 CDD:128966 27/46 (59%)
UBA_PLICs 501..537 CDD:270582 30/36 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 538 1.000 Inparanoid score I1180
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1553668at2759
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T610151
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 O PTHR10677
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.