DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and Ubqln2

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_001101721.1 Gene:Ubqln2 / 317396 RGDID:1563566 Length:638 Species:Rattus norvegicus

Alignment Length:641 Identity:553/642 (86%)
Similarity:590/642 (92%) Gaps:20/642 (3%)


Human     1 MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRF 65
            ||||||||||||||||||||.|:|..||||||||||||||||||||||||||:||||||||||||
  Rat     1 MAENGESSGPPRPSRGPAAAPGAANPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRF 65

Human    66 KSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQ-STQPSNAAGTNTTSAST- 128
            |||||||||||||||||||||||||||||||||||||||||||||| :||||..|||:||:.:| 
  Rat    66 KSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTAGTSTTTTTTT 130

Human   129 -------------PRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE 180
                         ||.::|..:|||:..||||   ||.|.:|||:|:||:|||:||||||:||||
  Rat   131 TAAAPPAATTSSAPRCSTTATTTNSSNLGLGS---LASLGNLGLNSSNFTELQNQMQQQLLASPE 192

Human   181 MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQ 245
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   193 MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQ 257

Human   246 EMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRT 310
            ||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||
  Rat   258 EMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFATVGSSSSSGEGTQPSRT 322

Human   311 ENRDPLPNPWAPPPATQSSA-TTSTTTSTGSGSG-NSSSNATGNTVAAANYVASIFSTPGMQSLL 373
            ||||||||||||||.||:|| ||:||||:|:.:| |:||...|||:|||||||||||||||||||
  Rat   323 ENRDPLPNPWAPPPTTQTSATTTTTTTSSGTVAGSNTSSTTAGNTMAAANYVASIFSTPGMQSLL 387

Human   374 QQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQ 438
            |||||||||||||||||||||||||||||||:||||||:|||||||||||||||||||.||||||
  Rat   388 QQITENPQLIQNMLSAPYMRSMMQSLSQNPDMAAQMMLSSPLFTANPQLQEQMRPQLPNFLQQMQ 452

Human   439 NPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGP 503
            :|:|::|||||||||||:||||||||||||||||||.||||||||||||||.|||||||||||||
  Rat   453 SPETIAAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGVGVGVLGTAITPVGPVTPIGPIGP 517

Human   504 IVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALA 568
            |||||||||||||||||||:.|||||:|.|...||||:||:||.||||||||:|||||||||||.
  Rat   518 IVPFTPIGPIGPIGPTGPASSPGSTGTGIPPATTVSSSAPTETISPTSESGPSQQFIQQMVQALT 582

Human   569 GANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS 624
            |.:.||.|||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   583 GGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 69/70 (99%)
hPLIC_N 33..103 CDD:176403 69/70 (99%)
STI1 382..426 CDD:128966 42/44 (95%)
12 X 3 AA tandem repeats of P-X-X 491..526 33/35 (94%)
UBA_PLICs 581..620 CDD:270582 39/39 (100%)
Ubqln2NP_001101721.1 UBQ 33..103 CDD:214563 69/70 (99%)
hPLIC_N 33..103 CDD:176403 69/70 (99%)
STI1 194..227 CDD:128966 33/33 (100%)
STI1 393..440 CDD:128966 45/47 (96%)
UBA_PLICs 595..634 CDD:270582 39/39 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156737766
eggNOG 1 0.900 E1_COG5272
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H81830
Inparanoid 1 1.050 1070 1.000 Inparanoid score I4712
OMA 1 1.010
OrthoDB 1 1.010 D116115at9347
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T2465829
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 LDO PTHR10677
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1414.270

Return to query results.
Submit another query.