DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and dph1

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_594159.1 Gene:dph1 / 2542667 PomBaseID:SPAC26A3.16 Length:354 Species:Schizosaccharomyces pombe

Alignment Length:598 Identity:124/599 (21%)
Similarity:191/599 (32%) Gaps:261/599 (44%)


Human    33 IKVTVKTPK-EKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGL 96
            |.:|:|... :|....|...|||...||||:.....:.::..||:||::|||:::|..:.|.||.
pombe     4 ISLTIKAANDQKYAVTVDSESSVLALKEAIAPVADIEKERQRLIYAGRVLKDEESLKTYKIQDGH 68

Human    97 TVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSS 161
            ::|||               ...|.|..:|:|..|:.|                           
pombe    69 SIHLV---------------KTLGQNPAAAATNVSDRT--------------------------- 91

Human   162 TNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLN 226
                                                               |.:..|.:.....|
pombe    92 ---------------------------------------------------QQVPTNIQAGQGAN 105

Human   227 NPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNP 291
            ||                          |:||.|         ..|.....||.:|:  .||.||
pombe   106 NP--------------------------LANLTS---------ARYAGFNIPMPSAS--MFGPNP 133

Human   292 FASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAA 356
                                     .||  .||:|:.                            
pombe   134 -------------------------ENP--VPPSTEE---------------------------- 143

Human   357 ANYVASIFSTPGMQSLLQQITENPQLIQNML-SAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP 420
               :|::.|.|.:||.:.::..|||::..:: |:|::|                  |:|      
pombe   144 ---LANMLSNPMVQSSINEMFSNPQMLDMIINSSPHLR------------------NAP------ 181

Human   421 QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVL 485
                      |...|.||:|:...||::|..|:.:.|:.|.:.....:...|:.....|.|:|.|
pombe   182 ----------PYVRQMMQSPEFRRAMTDPDTMRQMAQLHQQMGAAGIDPMSLMGGGLGGAGLGGL 236

Human   486 GTA-IGPVG-------PVTPIGPIGPIVPFTPI-GPIGPIGPTGPAAPPGSTGSGGPTGPTVSSA 541
            |.| :|..|       .:....|:........| ..:..:|..|..|..|..|.|...|...|..
pombe   237 GGAGLGGFGGANNATAGIAGAAPVDQTAAANTIQNLLNNLGGAGFGAGLGDAGLGAGLGGAASPP 301

Human   542 APSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIA 606
            ||::.|.|                            ||.|:.:||.|||.|||::.|.|:|||..
pombe   302 APAQDTRP----------------------------PEERYAEQLSQLNEMGFVDFERNVQALRR 338

Human   607 TGGDINAAIERLL 619
            :||::..|||.||
pombe   339 SGGNVQGAIESLL 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 26/71 (37%)
hPLIC_N 33..103 CDD:176403 26/71 (37%)
STI1 382..426 CDD:128966 5/45 (11%)
12 X 3 AA tandem repeats of P-X-X 491..526 6/43 (14%)
UBA_PLICs 581..620 CDD:270582 21/40 (53%)
dph1NP_594159.1 UBQ 4..75 CDD:214563 26/86 (30%)
Scythe_N 4..75 CDD:176404 26/86 (30%)
STI1 142..180 CDD:128966 12/87 (14%)
UBA_Dsk2p_like 310..351 CDD:270509 22/41 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T998898
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 O PTHR10677
Phylome 1 0.910 0.947 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.