DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBQLN2 and ubql-1

DIOPT Version :8

Sequence 1:NP_038472.2 Gene:UBQLN2 / 29978 HGNCID:12509 Length:624 Species:Homo sapiens
Sequence 2:NP_740883.1 Gene:ubql-1 / 172434 WormBaseID:WBGene00008852 Length:502 Species:Caenorhabditis elegans

Alignment Length:603 Identity:218/604 (36%)
Similarity:303/604 (50%) Gaps:115/604 (19%)


Human    29 EPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRF-KSQTDQLVLIFAGKILKDQDTLIQHGI 92
            |..:|||.||:|..|.:..:..::||.:.|:.:.... .:..:|:.:|:.||||||::||.||.|
 Worm     4 ESALIKVHVKSPSNKYDVEIAADASVSELKDKVLVFVPTANKEQVCIIYTGKILKDEETLTQHKI 68

Human    93 HDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPIS----TNSNPF-GLGSLGGLA 152
            .||.||||||::|.||     .|:.||.|.|.| |.|.||.||.|    || ||| .:|.:|..|
 Worm    69 ADGHTVHLVIRNQARP-----TPAPAAATPTAS-SAPSSNPTPSSQPNPTN-NPFAAMGGMGSPA 126

Human   153 GLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQR 217
                                 .::.:|:.|..:|:||..|.:|.||:.||.:|.:|||.|.||:|
 Worm   127 ---------------------DILNNPDAMRSVMDNPITQQLLGNPEFMRTIIQSNPQFQALIER 170

Human   218 NPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNA 282
            |||:.|:||:|::||||:|:.|||.|.||||||.|.|:.||:.||||..||.|:|.|:|||:||:
 Worm   171 NPEVGHILNDPNVMRQTMEMIRNPNMFQEMMRNHDQAIRNLQGIPGGEAALERLYNDVQEPLLNS 235

Human   283 AQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSS 347
            |.....||||||:....||......:..||.:.||||||                  |.:..:::
 Worm   236 ATNSLSGNPFASLRGDQSSEPRVDRAGQENNEALPNPWA------------------SNANQATN 282

Human   348 NATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLN 412
            |.:.|..|..|   |:..:||:.||::|:..||.:..:|.|...:.|:.|::|.||.|...::..
 Worm   283 NQSNNRSADFN---SLLDSPGISSLMEQMMSNPSMQASMFSPEVINSIRQNMSNNPGLIDSIVGQ 344

Human   413 SPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFT 477
            .|....|||:.|.:|...|..|..|.:|..:.||.|||..:|..|||:|..||..|||.|:..|.
 Worm   345 IPSARDNPQISEGIRRSFPQMLNMMSDPSVMEAMRNPRVSEAFRQIQEGFSTLRREAPQLLNLFQ 409

Human   478 PGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGP----TGPTV 538
            .|...|                              |..|....|:..|:..:.|.    ....:
 Worm   410 AGAMGG------------------------------GAFGSDANASSAGANSANGLADLFNSMNM 444

Human   539 SSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQA 603
            ....||.|.:|.                          |||..:..|||||.:|||.:|..|:.|
 Worm   445 GGGRPSSTAAPV--------------------------NPEQTYASQLEQLQSMGFSDRARNVAA 483

Human   604 LIATGGDINAAIERLLGS 621
            |.||.||:|||:||||.|
 Worm   484 LTATFGDLNAAVERLLNS 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UBQLN2NP_038472.2 UBQ 33..103 CDD:214563 31/71 (44%)
hPLIC_N 33..103 CDD:176403 31/71 (44%)
STI1 382..426 CDD:128966 13/44 (30%)
12 X 3 AA tandem repeats of P-X-X 491..526 3/35 (9%)
UBA_PLICs 581..620 CDD:270582 23/39 (59%)
ubql-1NP_740883.1 hPLIC_N 8..79 CDD:176403 31/71 (44%)
UBQ 18..>372 CDD:333228 155/403 (38%)
UBA_PLICs 461..500 CDD:270582 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5272
Hieranoid 1 1.000
Homologene 1 1.000 H81830
Inparanoid 1 1.050 366 1.000 Inparanoid score I1377
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1553668at2759
OrthoFinder 1 1.000 FOG0000468
OrthoInspector 1 1.000 T390011
orthoMCL 1 0.900 OOG5_127163
Panther 1 1.100 O PTHR10677
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.