DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dhrs7l1 and CG31937

Sequence 1:NP_001013116.1 Gene:Dhrs7l1 RGDID:1308036 Length:324 Species:Rattus norvegicus
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:303 Identity:106/304 (35%)
Similarity:163/304 (54%) Gaps:19/304 (6%)


  Rat     1 MMGFEFWMLALCALLLLVLGLLSFLWLDSDLTLLRAAWMGQCPEQALADKVVWITGASSGIGEEL 65
            |...||.:|.|  :|..|:.:|.::.||.::.|...:..| ....::..:||||||||||||..|
  Fly     1 MSFLEFLLLLL--VLYYVVYVLLWILLDCNVALWYKSRFG-VSLSSMRGQVVWITGASSGIGRAL 62

  Rat    66 AFQLSKLGVCLVLSARRGQELERVKRRCL--ENGNLKEKDILVLPLDLADTSSHDIATKTVLQEF 128
            |..|::.||.|||||||.::||:|:..||  ..|.|..||:||:.:|:.|...|.....|||..|
  Fly    63 ALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHF 127

  Rat   129 GRIDILVNNGGVAHASLVENTNMDIFKVLIEVNYLGTVSLTKCVLPHMMERN--QGKIVVMKSLV 191
            .|:|:||||.|.:..:......:::.:.|.|::....|.|::.|:.:.:|:|  :|.|....|:.
  Fly   128 HRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192

  Rat   192 GIVPRPLCSGYAASKLALRGFFDVLRTELFDYPGITLSMICPGPVHSNIFQNAFTGDFTETRLPK 256
            |..|.|....|.|:|.||..:...|:.|:   ..:.:|:..|||:.::..|.||||    ::..|
  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVEM---RKLDVSLFAPGPIATDFLQEAFTG----SQGGK 250

  Rat   257 IPLF-----KMETSRCVQLILVSLANDLEDIWIANQPVLLRAY 294
            :.|.     :|...||..|..|:|||.::..|....||.|.||
  Fly   251 VGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAY 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dhrs7l1NP_001013116.1 11beta-HSD1_like_SDR_c 47..305 CDD:187593 94/258 (36%)
adh_short 50..247 CDD:278532 77/201 (38%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 93/256 (36%)
adh_short 47..245 CDD:278532 77/201 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255472648
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4124
OMA 1 1.010
OrthoDB 1 1.010 D429842at33208
OrthoFinder 1 1.000 FOG0006415
OrthoInspector 1 1.000 T618913
orthoMCL 1 0.900 OOG5_131445
Panther 1 1.100 O PTHR44269
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.