DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RBM15B and CG4266

Sequence 1:NP_037418.3 Gene:RBM15B HGNCID:24303 Length:890 Species:Homo sapiens
Sequence 2:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster

Alignment Length:403 Identity:79/404 (20%)
Similarity:114/404 (28%) Gaps:170/404 (42%)


Human     5 SERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPARARDKPRGSGSGGGGHRD 69
            ::|...|:|.|.:.........    :.||...|..:.||            |.|:|:|||| ..
  Fly   955 NQRMGGPAGNGGNGVGPMFMRN----QGGGPGGAGPSGGG------------PGGAGTGGGG-PG 1002

Human    70 GRGTG----------DANHRASSGRSSG-----SGAGGGGRGG---------------KASGDPG 104
            ||..|          :.|.|...|:|.|     .|.||||.||               |..|.||
  Fly  1003 GRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPG 1067

Human   105 ASGMS-------------------------PRASPLPP--------------------------- 117
            ..|.:                         ||.....|                           
  Fly  1068 GPGGNRFRGERGGEMMDDRRGNNSRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEGNKAA 1132

Human   118 ---PPPPPGAEPACPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPEL 179
               .|.|...|.....::..||...|.:.:........:..|.|:  :.::.||.:.:.:::|  
  Fly  1133 SETEPKPKNVETELGSTNTGAPAAATRVDTEEDWDQELQDYEARM--EAQKPGERASQSANSP-- 1193

Human   180 GRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGGSSRRSSSSSAAAST------ 238
                      ||:...|.....|:...:...||..             :|.:.::||.|      
  Fly  1194 ----------PQEKLPAENENFAKPADVTGDPLVA-------------KSQTETSAACTPLYDEL 1235

Human   239 PPPGPP-----APADPLGYLPLHGGYQYKQRSLSPV---------------------AAPPLREP 277
            |||..|     .|.:|.|..|         |...||                     .||...||
  Fly  1236 PPPAVPQTPTQPPKEPQGSPP---------RPAPPVIETEAAPHEESVPAPPAELQTEAPSAEEP 1291

Human   278 RARHAAAAFALDA 290
            .|..|:|....:|
  Fly  1292 IAPAASADVVAEA 1304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RBM15BNP_037418.3 RRM1_RBM15B 137..218 CDD:240998 12/81 (15%)
RRM2_RBM15B 329..413 CDD:241000
RRM3_RBM15B 416..491 CDD:241002
RRM 529..>639 CDD:330708
Nuclear localization signal. {ECO:0000255} 593..597
SPOC 712..887 CDD:311609
Interaction with Epstein-Barr virus BMLF1 722..890
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302 25/134 (19%)
Herpes_DNAp_acc <1206..1304 CDD:282746 25/120 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.