DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mga and byn

Sequence 1:XP_006499750.1 Gene:Mga MGIID:1352483 Length:3091 Species:Mus musculus
Sequence 2:NP_524031.2 Gene:byn FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster

Alignment Length:418 Identity:120/419 (29%)
Similarity:174/419 (42%) Gaps:112/419 (27%)


Mouse    14 GGTVTGGAPTFFVILKQPGNGK--------TDQGILVTNRDARALLSRESSPGKSKEKICLPADC 70
            ||....|:|. .|.....|:|.        :..|..|:......::....||.:...        
  Fly    30 GGGAGSGSPQ-HVTHNGHGHGHGLGGVAAVSGGGASVSGNGGHRVVGGAGSPNELDR-------- 85

Mouse    71 TVGKITVTLDNNSMWNEFHNRSTEMILTKQGRRMFPYCRYWITGLDSNLKYILVMDISPVDSHRY 135
               .:.::||:..:|..|.|.:.|||:||.||||||..:...:|||....|.::::...:||||:
  Fly    86 ---NLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRW 147

Mouse   136 KWNGRWWEPSGKAEPHILGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQEGHIILHSMHRY 200
            |:....|.|.||||......:::|||||:.|.:||.:|:||.|:||||.| :..|.|:|:|:|:|
  Fly   148 KYVNGEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNKT-NGNGQIMLNSLHKY 211

Mouse   201 LPRLHLV-PAEKATEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKIDYNPFAKGFRD---- 260
            .||:||| ...:...|:        |:.||:|:|.|||||||.::|.|||.||||||.|.|    
  Fly   212 EPRVHLVRVGSEQRHVV--------TYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDAKER 268

Mouse   261 ----------------------------------------------DGLSSKPQREGKQRNSSDQ 279
                                                          ..:||..........|.|:
  Fly   269 PDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGSCDR 333

Mouse   280 EGNSVSS--------SPAHRVRLTEGEGSEIHSGDFDPVLRGHEASSLSLEKAPHNVKQDFLGFM 336
            .|.|:||        :|..|.|:..|.||...:|:         |||.|.:              
  Fly   334 YGRSLSSRSVAPTRTTPYSRPRVVSGSGSNGSAGN---------ASSTSPQ-------------- 375

Mouse   337 NTDSTHEVPQLKHEISESRIVNSFEDDS 364
             ..|..:.|...|..|...:..|....|
  Fly   376 -PPSAPQTPTSLHSTSTGSVSTSVSSSS 402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MgaXP_006499750.1 TBOX 74..264 CDD:238106 84/241 (35%)
DUF4801 1038..1084 CDD:292677
Big_3_5 1620..1704 CDD:293246
HLH 2452..2502 CDD:278439
bynNP_524031.2 TBOX 86..268 CDD:238106 84/191 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.