DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CYP2S1 and Cyp303a1

Sequence 1:NP_085125.1 Gene:CYP2S1 HGNCID:15654 Length:504 Species:Homo sapiens
Sequence 2:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster

Alignment Length:492 Identity:133/493 (27%)
Similarity:228/493 (46%) Gaps:44/493 (9%)


Human    18 LLTLALSGTRARGHLPPGPTPLPLLGNLLQL-----RPGALYSGLMRLSKKYGPVFTIY---LGP 74
            ||.:...|.|.....||||...|::|:.||:     |.|.....:...:::|...:..|   :|.
  Fly    13 LLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGK 77

Human    75 WRPVVVLVGQEAVREALGGQAEEFSGR--GTVAMLEGTFDGH-GVFFSNGERWRQLRKFTMLALR 136
            .: ||:....:|:.|.:..  |:..||  |....|. ||:.. ||..::||.|.:.|:|.:..|:
  Fly    78 DK-VVIAYTNDAISEMMTN--EDIDGRPDGIFYRLR-TFNSRLGVLLTDGEMWVEQRRFILRHLK 138

Human   137 DLGMGKREGEELIQAEARCLVETFQ------GTEGRPFDPSLLLAQATSNVVCSLLFGLRFSYED 195
            :.|..:....:::..||.||::..:      |.:....:...|.:....|.:..:|.|.|:....
  Fly   139 NFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGS 203

Human   196 KEFQAVVRAAGGTLLGVSSQGGQTYEMFSW-----FLRPLPGPHKQLLHHVSTLAAFTVRQVQQH 255
            .|...::.........:...|.    :||.     |:.|....:...:....:|..|..::::.|
  Fly   204 PEITQLLETFFELFKNIDMVGA----LFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELH 264

Human   256 QGNLDASGPARDLVDAFLLKMAQEEQNPGT-EFTNKNMLMTVIYLLFAGTMTVSTTVGYTLLLLM 319
            :.........|||:|::|  .||:|.|... .|:::::|...:.:..||:.|.:.::|:..:.|:
  Fly   265 RLTYKNYDEPRDLMDSYL--RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLV 327

Human   320 KYPHVQKWVREELNRELGAGQAPSLG-DRTRLPYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRG 383
            ..|.:|:...:|:...:|..:.|... |||:|||.:|:..||.|:..|...|||...:..||..|
  Fly   328 LQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSG 392

Human   384 YTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDADGRFRKHEAFLPFSLGKRVCLGEGLAKA 448
            |.:|:.|.|......:|.:|..|..||.|||||:| .||..:..|||.||..|:..|:|:.|.:.
  Fly   393 YEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFNPFGFGRHRCMGDLLGRQ 456

Human   449 ELFLFFTTILQAFSL---------ESPCPPDTLSLKP 476
            .||:|.||:||.|.:         |.|....|.::||
  Fly   457 NLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKP 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CYP2S1NP_085125.1 p450 49..492 CDD:306555 121/457 (26%)
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 124/463 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112520444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.