DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp11a1 and Cyp12b2

Sequence 1:NP_058982.1 Gene:Cyp11a1 RGDID:69325 Length:526 Species:Rattus norvegicus
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:495 Identity:133/496 (27%)
Similarity:223/496 (45%) Gaps:41/496 (8%)


  Rat    44 RSFNEIPSPGDNGWINLYHFLRENG----THRIHYHHMQNFQKYGPIY--REKLGNMESVYILDP 102
            |||.|||.|   ..:.:..|....|    |:.|..:.:.. :.||.||  ...:|...:|:..:|
  Fly    51 RSFGEIPGP---SLLRMLSFFMPGGALRNTNLIQMNRLMR-EMYGDIYCIPGMMGKPNAVFTYNP 111

  Rat   103 KDAATLFSCEGPNPERYLVPPWVAYHQYYQRPI------GVLFKSSDAWRKDRIVLNQEVMAPDS 161
            .|....:..||..|.|..:.. :.|::...||.      |:.......|...|..:|..:|...:
  Fly   112 DDFEMTYRNEGVWPIRIGLES-LNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQN 175

  Rat   162 IKNFVPLLEGVAQDFIKVLHRRIKQQNSGKFSGDISDDLFRFAFESITSVVFGERLGMLEEIVDP 226
            ::..:|.|:.::::||..|..: :...:...:.|..:.|..:|||||:.|....|:|:|.:..||
  Fly   176 VRQNLPQLDQISKEFIDKLETQ-RNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDP 239

  Rat   227 ESQRFIDAVYQMFHTSVPMLNMPPDLFRLFRTKTWKDHAAAWDVIFSKADEYTQNFYWDLRQ--- 288
            .:.|....:...|:.|. ..::.|.::..::|..:|.....:|.|    .:.|.|:.....:   
  Fly   240 NADRLAKHMRDFFNYSF-QFDVQPSIWTFYKTAGFKKFLKTYDNI----TDITSNYIETAMRGFG 299

  Rat   289 KRDFSKYPGVLYSLLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEV 353
            |.|..|...||..||..||   |.....:.:||..|:||||......||.:|.|...||.||.|:
  Fly   300 KNDDGKTKCVLEQLLEHNK---KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRREL 361

  Rat   354 LAARRQAQGDMA-KMVQLVPLLKASIKETLRLHPISVTLQRYIVNDLVLRNYKIPAKTLVQVASY 417
            |......:..:. :..:.:|.|:|.|||.||:..|:....|....||||..|::|..|.|.:...
  Fly   362 LRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVL 426

  Rat   418 AMGRESSFFPNPNKFDPTRWLEK-----------SQNTTHFRYLGFGWGVRQCLGRRIAELEMTI 471
            .:..:..:|...::|.|.|||:.           ::....|.||.||:|.|.|:|:||||||:..
  Fly   427 ELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIET 491

  Rat   472 FLINVLENFRIEVQSIRDVGTKFNLILMPEKPIFFNFQPL 511
            .|:.:|.::::.......:..:..:||.|...|.|..:|:
  Fly   492 LLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKLEPV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp11a1NP_058982.1 p450 50..508 CDD:278495 127/485 (26%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 121/466 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.