DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GTF2H4 and mrn

DIOPT Version :8

Sequence 1:NP_001508.1 Gene:GTF2H4 / 2968 HGNCID:4658 Length:462 Species:Homo sapiens
Sequence 2:NP_648780.1 Gene:mrn / 39688 FlyBaseID:FBgn0261109 Length:499 Species:Drosophila melanogaster

Alignment Length:474 Identity:241/475 (51%)
Similarity:321/475 (68%) Gaps:22/475 (5%)


Human     8 GLNRVHLQCRNLQEFL-GGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAV 71
            |....:|:|::.||:| ...:|..|::||.:|..|||||||||.:|:.:::|:||::||:|||.|
  Fly    26 GQGPANLECKDFQEYLRTRQTPESLEKLYNYPPICLAVFRELPEIARQFIIRILFVDQPVPQAVV 90

Human    72 ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQL 136
            ..|..:..:|.|.|:|..|:.|.:|....:||||....|:|.|::::|..||||||.| ..|:.|
  Fly    91 TSWGAQRCAKEQAEATSCLTALNVWRVTAIPGGLSAWELSPTFKKSVRQVLLGGGKPW-PMTNTL 154

Human   137 GPDKHARDVPSLDKYAEERWEVVLHFMV------GSPSAAVSQDLAQLLSQAGLMKSTEPGEPPC 195
            ..|...||:..||.||..||..|||:||      |:.:.|:|.|..::|..|.|||..| .:...
  Fly   155 DKDSKPRDIAFLDTYAMSRWRCVLHYMVGTGNRNGTDAEAISPDAVRILLHANLMKRDE-RDGIT 218

Human   196 ITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLN 260
            ||..|||||||||.||:|:||||||.|.:.||:.|.|.||.||||||||||:|||.|||:..:|.
  Fly   219 ITRQGFQFLLLDTRAQVWHFMLQYLDTCEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLT 283

Human   261 FLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTV-------HQPGFIVVETNYRLYAY 318
            |||||||||||||||||..|:||||||:|::|..:.|..:|       ...|:||||||||:|||
  Fly   284 FLQHLREFGLVFQRKRKEGRFYPTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAY 348

Human   319 TESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVM------L 377
            |:|.||:|::.||:|:||||||:||..:||:||:||:..||||:||:.:|...|||.|      :
  Fly   349 TDSPLQVAVLGLFTELLYRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRMVESAI 413

Human   378 KQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMV 442
            .....||||:.|||:||||||:|..:|||||||||||..||..|..:|:.:.:||::|...|.||
  Fly   414 HSKSCLPPTVVDQIKLWELERNRFTYTEGVLYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMV 478

Human   443 VTPAGHSDVKRFWKRQKHS 461
            |...||.||||:||:...|
  Fly   479 VQKNGHDDVKRYWKKYSKS 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GTF2H4NP_001508.1 tfb2 18..460 CDD:273180 237/462 (51%)
mrnNP_648780.1 Tfb2 39..403 CDD:281797 189/366 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C231592779
eggNOG 1 0.900 E1_COG5144
Hieranoid 1 1.000
Homologene 1 1.000 H7090
Inparanoid 1 1.050 462 1.000 Inparanoid score I1536
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D433426at33208
OrthoFinder 1 1.000 FOG0003251
OrthoInspector 1 1.000 T1074915
orthoMCL 1 0.900 OOG5_128887
Panther 1 1.100 LDO PTHR13152
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1501
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.