DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Psma7 and Prosalpha2

Sequence 1:NP_001008218.1 Gene:Psma7 RGDID:61851 Length:248 Species:Rattus norvegicus
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:236 Identity:90/237 (38%)
Similarity:141/237 (59%) Gaps:14/237 (6%)


  Rat     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDD 67
            |..::|.|||.|.|.|:|||..||..|:.:||:...:.||:..|.|..:.|.::.:|.::..:.:
  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70

  Rat    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132
            ::.|.::|:..|.|:::.:||...|::.||.::|:.|..:.:.:|:|.|.||||.|.||||:|.|
  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135

  Rat   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYT-----DDAIETDDLTIKLVI 192
            |.|:|.| .|.|||:||||.|.||||.|:|:.|.:.:.||||.|:     |||:.|..||:|...
  Fly   136 ICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGF 199

  Rat   193 KALLEVVQSGGKNIELAVMRRDQ-PLKILSPEEIEKYVAEI 232
            :..:.     ..|||:.:.  || ..:.|.|..|:.|:|.|
  Fly   200 EGKMT-----ADNIEIGIC--DQNGFQRLDPASIKDYLASI 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Psma7NP_001008218.1 PRK03996 1..230 CDD:235192 88/233 (38%)
proteasome_alpha_type_7 3..211 CDD:239724 82/213 (38%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 89/235 (38%)
proteasome_alpha_type_2 6..231 CDD:239719 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.