DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Psma5 and Prosalpha2

Sequence 1:NP_058978.2 Gene:Psma5 RGDID:61848 Length:241 Species:Rattus norvegicus
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:215 Identity:75/216 (35%)
Similarity:120/216 (56%) Gaps:5/216 (2%)


  Rat     3 LTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKI 67
            :....|...:.||||.|:|.|:|||:.|:..|:.::||..|.||.:|.|.:..|||.|..|:.::
  Fly     1 MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRV 65

  Rat    68 VEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGA 132
            ..|..|||...||:..|.:.|:.:||...|.::.||.|.:.|..:.|.|:.|.    :|....|.
  Fly    66 EMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLM----QEYTQSGG 126

  Rat   133 MSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKS 197
            : |||||:||..|.|...|.|:..||||.:....|.|:|..:...::.|::.|.:.:.|.:|:.:
  Fly   127 V-RPFGVSLLICGWDNDRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHT 190

  Rat   198 SLIILKQVMEEKLNATNIEL 217
            :::.||:..|.|:.|.|||:
  Fly   191 AILTLKEGFEGKMTADNIEI 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 75/211 (36%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 75/211 (36%)
proteasome_alpha_type_2 6..231 CDD:239719 75/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.