DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pou3f2 and pdm2

Sequence 1:NP_742082.2 Gene:Pou3f2 RGDID:61946 Length:445 Species:Rattus norvegicus
Sequence 2:NP_001285877.1 Gene:pdm2 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster

Alignment Length:347 Identity:141/348 (41%)
Similarity:173/348 (50%) Gaps:84/348 (24%)


  Rat   124 LQQQHQQQQQQQQQQQQQQQQQQQ----------QQQQRPPHLVHHAANHHPGPGAWRSAAAAAH 178
            ||...|...|.|..||.:|||::.          :...|.|.|       .|.|   |.:.:...
  Fly   571 LQNSLQALAQFQALQQMKQQQREDPLPSYSTPLAKSPLRSPSL-------SPVP---RHSKSQQR 625

  Rat   179 LPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPP 243
            .||:             |.|.|.:             |:..|...|    :.|.....|..|...
  Fly   626 TPPN-------------SMTANSL-------------GMSSAVMTP----NTPSMQQQPQLQQST 660

  Rat   244 PPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQT 308
            |.|..|............|.|:|...::||||||.||||||||||||.|||||:|.||||.||||
  Fly   661 PKPTSGLTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQT 725

  Rat   309 TICRFEALQLSFKNMCKLKPLLNKWLEEADSS------------------SGSPTSIDKIAAQGR 355
            ||.|||||.|||||||||||||.||||:|||:                  |.:|.||     .||
  Fly   726 TISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESI-----LGR 785

  Rat   356 KRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTP---- 416
            :||||||||.:|:..||..||...||:::||:.|::.|.::|||:|||||||||||||:.|    
  Fly   786 RRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLDL 850

  Rat   417 --PGGTLPGAEDVYGGSRDTPP 436
              |.|| |.:...:|    .||
  Fly   851 DSPTGT-PLSSHAFG----YPP 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pou3f2NP_742082.2 POU 264..338 CDD:197673 59/74 (80%)
Homeobox 359..412 CDD:278475 31/53 (58%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 55/64 (86%)
Homeobox 789..842 CDD:278475 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11636
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.