DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GSTT2 and GstD10

Sequence 1:NP_000845.2 Gene:GSTT2 HGNCID:4642 Length:244 Species:Homo sapiens
Sequence 2:NP_001287302.1 Gene:GstD10 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster

Alignment Length:215 Identity:58/216 (27%)
Similarity:103/216 (48%) Gaps:21/216 (10%)


Human     3 LELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHK-SKEFLQINSLGKLPTLKDGDFILTE 66
            ::|:....|.|.|:|.:.||..|:..:.:|:...:.:.: :.|:|:||....:|||.|..|.|.|
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

Human    67 SSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEK 131
            |.||::||..||...|..:|.|:|.:|.:::.|.:....:..:|....:.|:.       :.|..
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIF-------LKKPA 123

Human   132 VERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAW--- 193
            .|.|...::.|.::| :.||..:.:.||...:|||:..|..:......|:: |:....:|.|   
  Fly   124 NEENYKKIEVAFEFL-NTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFD-FKRYANVARWYEN 186

Human   194 -----RGRVEAFLGAELCQE 208
                 .|..|.:.|   |||
  Fly   187 AKKLTPGWEENWAG---CQE 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 26/76 (34%)
GstA 14..210 CDD:223698 55/205 (27%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 1/1 (100%)
GST_C_Theta 91..216 CDD:198292 27/127 (21%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 25/74 (34%)
PLN02473 3..196 CDD:166114 53/202 (26%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95566949
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.